Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA26515_WB6.jpg WB (Western Blot) (Western Blot analysis of SMAD3 expression in transfected 293T cell line by SMAD3 monoclonal antibody (M07), clone 1B7.Lane 1: SMAD3 transfected lysate (48 KDa).Lane 2: Non-transfected lysate.)

Mouse SMAD3 Monoclonal Antibody | anti-SMAD3 antibody

SMAD3 (SMAD Family Member 3, DKFZp586N0721, DKFZp686J10186, HSPC193, HsT17436, JV15-2, MADH3, MGC60396) (HRP)

Gene Names
SMAD3; LDS3; LDS1C; MADH3; JV15-2; HSPC193; HsT17436
Applications
Western Blot
Purity
Purified
Synonyms
SMAD3, Antibody; SMAD3 (SMAD Family Member 3, DKFZp586N0721, DKFZp686J10186, HSPC193, HsT17436, JV15-2, MADH3, MGC60396) (HRP); SMAD Family Member 3; DKFZp586N0721; DKFZp686J10186; HSPC193; HsT17436; JV15-2; MADH3; MGC60396; anti-SMAD3 antibody
Ordering
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1B7
Specificity
Recognizes SMAD3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-SMAD3 antibody
WB (Western Blot)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SMAD3 (NP_005893, 1aa-110aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCE
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(Western Blot analysis of SMAD3 expression in transfected 293T cell line by SMAD3 monoclonal antibody (M07), clone 1B7.Lane 1: SMAD3 transfected lysate (48 KDa).Lane 2: Non-transfected lysate.)

product-image-AAA26515_WB6.jpg WB (Western Blot) (Western Blot analysis of SMAD3 expression in transfected 293T cell line by SMAD3 monoclonal antibody (M07), clone 1B7.Lane 1: SMAD3 transfected lysate (48 KDa).Lane 2: Non-transfected lysate.)

WB (Western Blot)

(SMAD3 monoclonal antibody (M07), clone 1B7. Western Blot analysis of SMAD3 expression in Raw 264.7 (Cat # L024V1).)

product-image-AAA26515_WB5.jpg WB (Western Blot) (SMAD3 monoclonal antibody (M07), clone 1B7. Western Blot analysis of SMAD3 expression in Raw 264.7 (Cat # L024V1).)

WB (Western Blot)

(SMAD3 monoclonal antibody (M07), clone 1B7. Western Blot analysis of SMAD3 expression in PC-12 (Cat # L012V1).)

product-image-AAA26515_WB4.jpg WB (Western Blot) (SMAD3 monoclonal antibody (M07), clone 1B7. Western Blot analysis of SMAD3 expression in PC-12 (Cat # L012V1).)

WB (Western Blot)

(SMAD3 monoclonal antibody (M07), clone 1B7. Western Blot analysis of SMAD3 expression in NIH/3T3 (Cat # L018V1).)

product-image-AAA26515_WB3.jpg WB (Western Blot) (SMAD3 monoclonal antibody (M07), clone 1B7. Western Blot analysis of SMAD3 expression in NIH/3T3 (Cat # L018V1).)

Application Data

(Detection limit for recombinant GST tagged SMAD3 is approximately 3ng/ml as a capture antibody.)

product-image-AAA26515_APP2.jpg Application Data (Detection limit for recombinant GST tagged SMAD3 is approximately 3ng/ml as a capture antibody.)

WB (Western Blot)

(SMAD3 monoclonal antibody (M07), clone 1B7 Western Blot analysis of SMAD3 expression in HeLa (Cat # L013V1).)

product-image-AAA26515_WB.jpg WB (Western Blot) (SMAD3 monoclonal antibody (M07), clone 1B7 Western Blot analysis of SMAD3 expression in HeLa (Cat # L013V1).)
Product Categories/Family for anti-SMAD3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
50.2 kDa (445aa), confirmed by MALDI-TOF.
NCBI Official Full Name
mothers against decapentaplegic homolog 3 isoform 1
NCBI Official Synonym Full Names
SMAD family member 3
NCBI Official Symbol
SMAD3
NCBI Official Synonym Symbols
LDS3; LDS1C; MADH3; JV15-2; HSPC193; HsT17436
NCBI Protein Information
mothers against decapentaplegic homolog 3
UniProt Protein Name
Mothers against decapentaplegic homolog 3
UniProt Gene Name
SMAD3
UniProt Synonym Gene Names
MADH3; MAD homolog 3; Mad3; Mothers against DPP homolog 3; hMAD-3; SMAD 3; Smad3; hSMAD3
UniProt Entry Name
SMAD3_HUMAN

Similar Products

Product Notes

The SMAD3 smad3 (Catalog #AAA26515) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SMAD3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SMAD3 smad3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SMAD3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.