Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA24662_APP6.jpg Application Data (Detection limit for recombinant GST tagged SMN2 is ~0.3ng/ml as a capture antibody.)

Mouse anti-Human SMN2 Monoclonal Antibody | anti-SMN2 antibody

SMN2 (Survival Motor Neuron Protein, Component of Gems 1, SMN1, Gemin-1, SMN, SMNT, SMNC, FLJ76644, MGC20996, MGC5208) APC

Gene Names
SMN2; SMNC; BCD541; GEMIN1; TDRD16B; C-BCD541
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SMN2, Antibody; SMN2 (Survival Motor Neuron Protein, Component of Gems 1, SMN1, Gemin-1, SMN, SMNT, SMNC, FLJ76644, MGC20996, MGC5208) APC; anti-SMN2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B11-2A9
Specificity
Recognizes human SMN2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
1442
Applicable Applications for anti-SMN2 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 1-10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-283 from human SMN2 (AAH00908) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMEMLA
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Application Data

(Detection limit for recombinant GST tagged SMN2 is ~0.3ng/ml as a capture antibody.)

product-image-AAA24662_APP6.jpg Application Data (Detection limit for recombinant GST tagged SMN2 is ~0.3ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to SMN2 on HeLa cell. [antibody concentration 1-10ug/ml].)

product-image-AAA24662_IF5.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to SMN2 on HeLa cell. [antibody concentration 1-10ug/ml].)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to SMN2 on formalin-fixed paraffin-embedded human heart tissue. [antibody concentration 1-10ug/ml].)

product-image-AAA24662_IHC4.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to SMN2 on formalin-fixed paraffin-embedded human heart tissue. [antibody concentration 1-10ug/ml].)

WB (Western Blot)

(SMN2 monoclonal antibody, Western Blot analysis of SMN2 expression in IMR-32.)

product-image-AAA24662_WB3.jpg WB (Western Blot) (SMN2 monoclonal antibody, Western Blot analysis of SMN2 expression in IMR-32.)

WB (Western Blot)

(SMN2 monoclonal antibody. Western Blot analysis of SMN2 expression in human colon.)

product-image-AAA24662_WB2.jpg WB (Western Blot) (SMN2 monoclonal antibody. Western Blot analysis of SMN2 expression in human colon.)

WB (Western Blot)

(Western Blot detection against Immunogen (57.13kD).)

product-image-AAA24662_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (57.13kD).)
Product Categories/Family for anti-SMN2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens survival of motor neuron 2, centromeric, mRNA
NCBI Official Synonym Full Names
survival of motor neuron 2, centromeric
NCBI Official Symbol
SMN2
NCBI Official Synonym Symbols
SMNC; BCD541; GEMIN1; TDRD16B; C-BCD541
NCBI Protein Information
survival motor neuron protein

Similar Products

Product Notes

The SMN2 (Catalog #AAA24662) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SMN2 (Survival Motor Neuron Protein, Component of Gems 1, SMN1, Gemin-1, SMN, SMNT, SMNC, FLJ76644, MGC20996, MGC5208) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SMN2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 1-10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SMN2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SMN2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.