Mouse anti-Human Phospholipase C, gamma 1 Monoclonal Antibody | anti-PLCg1 antibody

Phospholipase C, gamma 1 (Phospholipase C-gamma-1, PLCgamma1, PLC-gamma-1, PLCg1, NCKAP3, 1-Phosphatidylinositol-4,5-bisphosphate Phosphodiesterase gamma-1, Phospholipase C-II, PLC-II, Phosphoinositide Phospholipase C-gamma-1, PLC1, PLC148, PLC-148) (HRP)

Cat. Num. AAA25497

• Gene Names: PLCG1; PLC1; NCKAP3; PLC-II; PLC148; PLCgamma1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Phospholipase C, gamma 1, Antibody; Phospholipase C, gamma 1 (Phospholipase C-gamma-1, PLCgamma1, PLC-gamma-1, PLCg1, NCKAP3, 1-Phosphatidylinositol-4,5-bisphosphate Phosphodiesterase gamma-1, Phospholipase C-II, PLC-II, Phosphoinositide Phospholipase C-gamma-1, PLC1, PLC148, PLC-148) (HRP); anti-PLCg1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2A2
• Specificity: Recognizes human PLCG1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 1291

• Applicable Applications for anti-PLCg1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1192-1292 from human PLCG1 (NP_002651) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LKNNYSEDLELASLLIKIDIFPAKQENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFESRYQQPFEDFRISQEHLADHFDSRERRAPRRTRVNGDNRL
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Application Data

(Proximity Ligation Analysis of protein-protein interactions between PDGFRB and PLCG1. Mahlavu cells were stained with anti-PDGFRB rabbit purified polyclonal 1:600 and anti-PLCG1 mouse monoclonal antibody 1:100. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

Application Data

(Proximity Ligation Analysis of protein-protein interactions between HCK and PLCG1. Huh7 cells were stained with anti-HCK rabbit purified polyclonal 1:1200 and anti-PLCG1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

Application Data

(Proximity Ligation Analysis of protein-protein interactions between PTK2 and PLCG1 HeLa cells were stained with PTK2 rabbit purified polyclonal 1:1200 and PLCG1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

Application Data

(Detection limit for recombinant GST tagged PLCG1 is ~0.1ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to PLCG1 on HeLa cell. [antibody concentration 40ug/ml].)

WB (Western Blot)

(PLCG1 monoclonal antibody. Western Blot analysis of PLCG1 expression in Hela NE.)

WB (Western Blot)

(Western Blot detection against Immunogen (36.74kD).)

Product Categories/Family for anti-PLCg1 antibody

Antibodies; Enzymes; Phospholipase

NCBI and Uniprot Product Information

• NCBI GI #: 33598948
• NCBI GeneID: 5335
• NCBI Accession #: NP_002651
• NCBI GenBank Nucleotide #: NM_002660
• UniProt Accession #: P19174
• NCBI Official Full Name: 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 isoform a
• NCBI Official Synonym Full Names: phospholipase C gamma 1
• NCBI Official Symbol: PLCG1
• NCBI Official Synonym Symbols: PLC1; NCKAP3; PLC-II; PLC148; PLCgamma1
• NCBI Protein Information: 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
• UniProt Protein Name: 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
• UniProt Gene Name: PLCG1
• UniProt Synonym Gene Names: PLC1; PLC-II; PLC-gamma-1
• UniProt Entry Name: PLCG1_HUMAN