Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA25255_WB7.jpg WB (Western Blot) (SMURF1 monoclonal antibody, Western Blot analysis of SMURF1 expression in HeLa.)

Mouse anti-Human, Mouse SMURF1 Monoclonal Antibody | anti-SMURF1 antibody

SMURF1 (E3 Ubiquitin-protein Ligase SMURF1, hSMURF1, SMAD Ubiquitination Regulatory Factor 1, KIAA1625, SMAD-specific E3 Ubiquitin-protein Ligase 1) (FITC)

Average rating 0.0
No ratings yet
Reactivity
Human, Mouse
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SMURF1, Antibody; SMURF1 (E3 Ubiquitin-protein Ligase SMURF1, hSMURF1, SMAD Ubiquitination Regulatory Factor 1, KIAA1625, SMAD-specific E3 Ubiquitin-protein Ligase 1) (FITC); EC=6.3.2.-; anti-SMURF1 antibody
Ordering
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D7
Specificity
Recognizes human SMURF1. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-SMURF1 antibody
ELISA, IF (Immunofluorescence), IHC (Immunohistochemistry), IP (Immunoprecipitation), WB (Western Blot)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa165-269 from human SMURF1 (NP_065162) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DSGPGRPLSCFMEEPAPYTDSTGAAAGGGNCRFVESPSQDQRLQAQRLRNPDVRGSLQTPQNRPHGHQSPELPEGYEQRTTVQGQVYFLHTQTGVSTWHDPRIP
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(SMURF1 monoclonal antibody, Western Blot analysis of SMURF1 expression in HeLa.)

product-image-AAA25255_WB7.jpg WB (Western Blot) (SMURF1 monoclonal antibody, Western Blot analysis of SMURF1 expression in HeLa.)

WB (Western Blot)

(Western Blot detection against Immunogen (37.55kD).)

product-image-AAA25255_WB6.jpg WB (Western Blot) (Western Blot detection against Immunogen (37.55kD).)

Application Data

(Detection limit for recombinant GST tagged SMURF1 is ~0.1ng/ml as a capture antibody.)

product-image-AAA25255_APP5.jpg Application Data (Detection limit for recombinant GST tagged SMURF1 is ~0.1ng/ml as a capture antibody.)

IP (Immunoprecipitation)

(Immunoprecipitation of SMURF1 transfected lysate using SMURF1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with SMURF1 rabbit polyclonal antibody.)

product-image-AAA25255_IP4.jpg IP (Immunoprecipitation) (Immunoprecipitation of SMURF1 transfected lysate using SMURF1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with SMURF1 rabbit polyclonal antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to SMURF1 on HeLa cell. [antibody concentration 10ug/ml].)

product-image-AAA25255_IF3.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to SMURF1 on HeLa cell. [antibody concentration 10ug/ml].)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to SMURF1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 2ug/ml].)

product-image-AAA25255_IHC2.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to SMURF1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 2ug/ml].)

WB (Western Blot)

(Western Blot analysis of SMURF1 expression in transfected 293T cell line by SMURF1 monoclonal antibody. Lane 1: SMURF1 transfected lysate (83.4kD). Lane 2: Non-transfected lysate.)

product-image-AAA25255_WB.jpg WB (Western Blot) (Western Blot analysis of SMURF1 expression in transfected 293T cell line by SMURF1 monoclonal antibody. Lane 1: SMURF1 transfected lysate (83.4kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-SMURF1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Predicted: 80; 83 kDa

Observed: 78 kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase SMURF1 isoform 1
NCBI Official Synonym Full Names
SMAD specific E3 ubiquitin protein ligase 1
NCBI Official Symbol
SMURF1
NCBI Protein Information
E3 ubiquitin-protein ligase SMURF1; hSMURF1; E3 ubiquitin ligase SMURF1; Smad-specific E3 ubiquitin ligase 1; Smad ubiquitination regulatory factor 1; SMAD-specific E3 ubiquitin-protein ligase 1

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SMURF1 (Catalog #AAA25255) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SMURF1 (E3 Ubiquitin-protein Ligase SMURF1, hSMURF1, SMAD Ubiquitination Regulatory Factor 1, KIAA1625, SMAD-specific E3 Ubiquitin-protein Ligase 1) (FITC) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's SMURF1 can be used in a range of immunoassay formats including, but not limited to, ELISA, IF (Immunofluorescence), IHC (Immunohistochemistry), IP (Immunoprecipitation), WB (Western Blot). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SMURF1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SMURF1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.