<
IP (Immunoprecipitation)
(Immunoprecipitation analysis of 600 ug extracts of HeLa cells using 3 ug STAT1 antibody (AAA282740). Western blot was performed from the immunoprecipitate using STAT1 antibody (AAA282740) at a dilution of 1:1000.)
Rabbit anti-Human STAT1 Monoclonal Antibody | anti-STAT1 antibody
STAT1 Rabbit mAb
Reactivity
Human
Applications
Chromatin Immunoprecipitation, Immunoprecipitation, ELISA, Immunoprecipitation, Western Blot
Purity
Affinity purification
Synonyms
STAT1, Antibody; STAT1 Rabbit mAb; CANDF7; IMD31A; IMD31B; IMD31C; ISGF-3; STAT91; STAT1; anti-STAT1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDLLSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQ
Applicable Applications for anti-STAT1 antibody
ChIP (Chromatin immunoprecipitation), ELISA, IP (Immunoprecipitation), WB (Western Blot)
Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human STAT1 (P42224).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
IP (Immunoprecipitation)
(Immunoprecipitation analysis of 600 ug extracts of HeLa cells using 3 ug STAT1 antibody (AAA282740). Western blot was performed from the immunoprecipitate using STAT1 antibody (AAA282740) at a dilution of 1:1000.)
IP (Immunoprecipitation)
(Immunoprecipitation analysis of 600 ug extracts of HeLa cells using 3 ug STAT1 antibody (AAA282740). Western blot was performed from the immunoprecipitate using STAT1 antibody (AAA282740) at a dilution of 1:1000.)
ChIP (Chromatin Immunoprecipitation)
(Chromatin immunoprecipitation was performed with 35 ug of cross-linked chromatin from HeLa cells treated by TNF-? (30ng/ml, 1h) using 5 ug of STAT1 Rabbit mAb (AAA282740). DNA libraries were prepared using Scale ssDNA-seq Lib Prep Kit for Illumina V2 (RK20228). The ChIP sequencing results indicate the enrichment pattern of STAT1 in the representative genomic region surrounding TAP1 gene.)
ChIP (Chromatin Immunoprecipitation)
(Chromatin immunoprecipitation was performed with 35 ug of cross-linked chromatin from HeLa cells treated by TNF-? (30ng/ml, 1h) using 5 ug of STAT1 Rabbit mAb (AAA282740). DNA libraries were prepared using Scale ssDNA-seq Lib Prep Kit for Illumina V2 (RK20228). The ChIP sequencing results indicate the enrichment pattern of STAT1 in the representative genomic region surrounding TAP1 gene.)
ChIP (Chromatin Immunoprecipitation)
(Chromatin immunoprecipitation was performed with 35 ug of cross-linked chromatin from HeLa cells treated by TNF-? (30ng/ml, 1h) using 5 ug of STAT1 Rabbit mAb (AAA282740). DNA libraries were prepared using Scale ssDNA-seq Lib Prep Kit for Illumina V2 (RK20228). The ChIP sequencing results indicate the enrichment pattern of STAT1 across chromosome 6 (upper panel) and the genomic region encompassing TAP1, a representative gene enriched in STAT1 (lower panel).)
ChIP (Chromatin Immunoprecipitation)
(Chromatin immunoprecipitation was performed with 35 ug of cross-linked chromatin from HeLa cells treated by TNF-? (30ng/ml, 1h) using 5 ug of STAT1 Rabbit mAb (AAA282740). DNA libraries were prepared using Scale ssDNA-seq Lib Prep Kit for Illumina V2 (RK20228). The ChIP sequencing results indicate the enrichment pattern of STAT1 across chromosome 6 (upper panel) and the genomic region encompassing TAP1, a representative gene enriched in STAT1 (lower panel).)
WB (Western Blot)
(Western blot analysis of various lysates using STAT1 Rabbit mAb (AAA282740) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)
WB (Western Blot)
(Western blot analysis of various lysates using STAT1 Rabbit mAb (AAA282740) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)
Related Product Information for anti-STAT1 antibody
The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. The protein encoded by this gene can be activated by various ligands including interferon-alpha, interferon-gamma, EGF, PDGF and IL6. This protein mediates the expression of a variety of genes, which is thought to be important for cell viability in response to different cell stimuli and pathogens. The protein plays an important role in immune responses to viral, fungal and mycobacterial pathogens. Mutations in this gene are associated with Immunodeficiency 31B, 31A, and 31C.
Product Categories/Family for anti-STAT1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated MW: 87kDa
Observed MW: 87kDa
Observed MW: 87kDa
UniProt Protein Name
Signal transducer and activator of transcription 1-alpha/beta
UniProt Gene Name
STAT1
UniProt Entry Name
STAT1_HUMAN
Similar Products
Product Notes
The STAT1 stat1 (Catalog #AAA282740) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STAT1 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's STAT1 can be used in a range of immunoassay formats including, but not limited to, ChIP (Chromatin immunoprecipitation), ELISA, IP (Immunoprecipitation), WB (Western Blot). Researchers should empirically determine the suitability of the STAT1 stat1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSQWYELQQL DSKFLEQVHQ LYDDSFPMEI RQYLAQWLEK QDWEHAANDV SFATIRFHDL LSQLDDQYSR FSLENNFLLQ HNIRKSKRNL QDNFQEDPIQ. It is sometimes possible for the material contained within the vial of "STAT1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.