Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA28496_IF6.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U2OS cells using SUPT5H/SPT5 Rabbit mAb (AAA28496) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

Rabbit anti-Human SUPT5H/SPT5 Monoclonal Antibody | anti-SUPT5H antibody

SUPT5H/SPT5 Rabbit mAb

Reactivity
Human
Applications
Western Blot, Immunohistochemistry, Immunofluorescence, Immunocytochemistry, ELISA
Purity
Affinity purification
Synonyms
SUPT5H/SPT5, Antibody; SUPT5H/SPT5 Rabbit mAb; SPT5; SPT5H; Tat-CT1; SUPT5H/SPT5; anti-SUPT5H antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
PHYGSQTPLHDGSRTPAQSGAWDPNNPNTPSRAEEEYEYAFDDEPTPSPQAYGGTPNPQTPGYPDPSSPQVNPQYNPQTPGTPAMYNTDQFSPYAAPSPQG
Applicable Applications for anti-SUPT5H antibody
WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence), ICC (Immunocytochemistry), ELISA
Application Notes
WB: 1:500-1:1000
IHC-P: 1:50-1:200
IF/ICC: 1:50-1:200
ELISA: Recommended starting concentration is 1ug/mL.
Please optimize the concentration based on your specific assay requirements.
Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 800-900 of human SUPT5H/SPT5 (O00267).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of U2OS cells using SUPT5H/SPT5 Rabbit mAb (AAA28496) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

product-image-AAA28496_IF6.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U2OS cells using SUPT5H/SPT5 Rabbit mAb (AAA28496) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of NIH/3T3 cells using SUPT5H/SPT5 Rabbit mAb (AAA28496) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

product-image-AAA28496_IF5.jpg IF (Immunofluorescence) (Immunofluorescence analysis of NIH/3T3 cells using SUPT5H/SPT5 Rabbit mAb (AAA28496) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of C6 cells using SUPT5H/SPT5 Rabbit mAb (AAA28496) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

product-image-AAA28496_IF4.jpg IF (Immunofluorescence) (Immunofluorescence analysis of C6 cells using SUPT5H/SPT5 Rabbit mAb (AAA28496) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using SUPT5H/SPT5 Rabbit mAb (AAA28496) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.)

product-image-AAA28496_IHC3.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using SUPT5H/SPT5 Rabbit mAb (AAA28496) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat ovary using SUPT5H/SPT5 Rabbit mAb (AAA28496) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.)

product-image-AAA28496_IHC2.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Rat ovary using SUPT5H/SPT5 Rabbit mAb (AAA28496) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of lysates from HeLa cells, using SUPT5H/SPT5 Rabbit mAb (AAA28496) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

product-image-AAA28496_WB.jpg WB (Western Blot) (Western blot analysis of lysates from HeLa cells, using SUPT5H/SPT5 Rabbit mAb (AAA28496) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
Related Product Information for anti-SUPT5H antibody
Enables enzyme binding activity and protein heterodimerization activity. Involved in positive regulation of macroautophagy; regulation of RNA metabolic process; and transcription elongation from RNA polymerase II promoter. Located in nucleoplasm. Part of DSIF complex.

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #
Molecular Weight
Calculated MW: 121kDa
Observed MW: 150kDa
UniProt Protein Name
Transcription elongation factor SPT5
UniProt Gene Name
SUPT5H
UniProt Synonym Gene Names
SPT5; SPT5H
UniProt Entry Name
SPT5H_HUMAN

Similar Products

Product Notes

The SUPT5H supt5h (Catalog #AAA28496) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SUPT5H/SPT5 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SUPT5H/SPT5 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence), ICC (Immunocytochemistry), ELISA. WB: 1:500-1:1000 IHC-P: 1:50-1:200 IF/ICC: 1:50-1:200 ELISA: Recommended starting concentration is 1ug/mL. Please optimize the concentration based on your specific assay requirements. Researchers should empirically determine the suitability of the SUPT5H supt5h for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PHYGSQTPLH DGSRTPAQSG AWDPNNPNTP SRAEEEYEYA FDDEPTPSPQ AYGGTPNPQT PGYPDPSSPQ VNPQYNPQTP GTPAMYNTDQ FSPYAAPSPQ G. It is sometimes possible for the material contained within the vial of "SUPT5H/SPT5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.