Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

WB (Western Blot) (Western blot analysis of BIRC5 over-expressed 293 cell line, cotransfected with BIRC5 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with BIRC5 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Mouse anti-Human Survivin Monoclonal Antibody | anti-BIRC5 antibody

Survivin (Apoptosis Inhibitor 4, API4, Apoptosis Inhibitor Survivin, Baculoviral IAP Repeat Containing Protein 5, BIRC5, EPR-1, IAP4) (Biotin)

Gene Names
BIRC5; API4; EPR-1
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Survivin; Monoclonal Antibody; Survivin (Apoptosis Inhibitor 4; API4; Apoptosis Inhibitor Survivin; Baculoviral IAP Repeat Containing Protein 5; BIRC5; EPR-1; IAP4) (Biotin); anti-BIRC5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5B10
Specificity
Recognizes human BIRC5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-BIRC5 antibody
ELISA (EIA), Immunofluorescence (IF), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-100 from human BIRC5 (NP_001159) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGE
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(Western blot analysis of BIRC5 over-expressed 293 cell line, cotransfected with BIRC5 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with BIRC5 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

WB (Western Blot) (Western blot analysis of BIRC5 over-expressed 293 cell line, cotransfected with BIRC5 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with BIRC5 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Application Data

(Detection limit for recombinant GST tagged BIRC5 is ~0.03ng/ml as a capture antibody.)

Application Data (Detection limit for recombinant GST tagged BIRC5 is ~0.03ng/ml as a capture antibody.)

IP (Immunoprecipitation)

(Immunoprecipitation of BIRC5 transfected lysate using BIRC5 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with BIRC5 rabbit polyclonal antibody.)

IP (Immunoprecipitation) (Immunoprecipitation of BIRC5 transfected lysate using BIRC5 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with BIRC5 rabbit polyclonal antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to BIRC5 on HeLa cell. [antibody concentration 10ug/ml].)

IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to BIRC5 on HeLa cell. [antibody concentration 10ug/ml].)

WB (Western Blot)

(Western Blot analysis of BIRC5 expression in transfected 293T cell line by BIRC5 monoclonal antibody. Lane 1: BIRC5 transfected lysate (16.4kD). Lane 2: Non-transfected lysate.)

WB (Western Blot) (Western Blot analysis of BIRC5 expression in transfected 293T cell line by BIRC5 monoclonal antibody. Lane 1: BIRC5 transfected lysate (16.4kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(Western Blot detection against Immunogen (36.74kD).)

WB (Western Blot) (Western Blot detection against Immunogen (36.74kD).)
Product Categories/Family for anti-BIRC5 antibody
References
1. Survivin expression induced by endothelin-1 promotes myofibroblast resistance to apoptosis. Horowitz JC, Ajayi IO, Kulasekaran P, Rogers DS, White JB, Townsend SK, White ES, Nho RS, Higgins PD, Huang SK, Sisson TH.Int J Biochem Cell Biol. 2011 Oct 25. 2. The Closely Related RNA helicases, UAP56 and URH49, Preferentially Form Distinct mRNA Export Machineries and Coordinately Regulate Mitotic Progression. Yamazaki T, Fujiwara N, Yukinaga H, Ebisuya M, Shiki T, Kurihara T, Kioka N, Kambe T, Nagao M, Nishida E, Masuda S.Mol Biol Cell. 2010 Aug 15;21(16):2953-65. Epub 2010 Jun 23.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
332
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17 kDa
NCBI Official Full Name
baculoviral IAP repeat-containing protein 5 isoform 1
NCBI Official Synonym Full Names
baculoviral IAP repeat containing 5
NCBI Official Symbol
BIRC5
NCBI Official Synonym Symbols
API4; EPR-1
NCBI Protein Information
baculoviral IAP repeat-containing protein 5; apoptosis inhibitor 4; survivin variant 3 alpha; apoptosis inhibitor survivin
UniProt Protein Name
Baculoviral IAP repeat-containing protein 5
UniProt Gene Name
BIRC5
UniProt Synonym Gene Names
API4; IAP4
UniProt Entry Name
BIRC5_HUMAN

Similar Products

Product Notes

The BIRC5 birc5 (Catalog #AAA24972) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Survivin (Apoptosis Inhibitor 4, API4, Apoptosis Inhibitor Survivin, Baculoviral IAP Repeat Containing Protein 5, BIRC5, EPR-1, IAP4) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Survivin can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunoprecipitation (IP), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BIRC5 birc5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Survivin, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.