Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA330078_IHC11.jpg IHC (Immunohistochemisry) (at 1/100 staining rat brain tissue by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-Mouse antibody was used as the secondary antibody.)

Mouse Synuclein alpha Monoclonal Antibody | anti-SNCA antibody

Synuclein alpha Mouse Monoclonal Antibody

Average rating 0.0
No ratings yet
Reactivity
Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Rabbit, Dog
Applications
Immunohistochemistry, Western Blot
Purity
Affinity-chromatography.
Synonyms
Synuclein alpha, Antibody; Synuclein alpha Mouse Monoclonal Antibody; Alpha synuclein; Alpha-synuclein; Alpha-synuclein, isoform NACP140; alphaSYN; MGC105443; MGC110988; MGC127560; MGC64356; NACP; Non A beta component of AD amyloid; Non A4 component of amyloid; Non A4 component of amyloid precursor; Non-A beta component of AD amyloid; Non-A-beta component of alzheimers disease amyloid, precursor of; Non-A4 component of amyloid precursor; Non-A4 component of amyloid, precursor of; OTTHUMP00000218549; OTTHUMP00000218551; OTTHUMP00000218552; OTTHUMP00000218553; OTTHUMP00000218554; PARK 1; PARK 4; PARK1; PARK4; Parkinson disease (autosomal dominant, Lewy body) 4; Parkinson disease familial 1; SNCA; Snca synuclein, alpha (non A4 component of amyloid precursor); SYN; Synuclein alpha; Synuclein alpha 140; Synuclein, alpha (non A4 component of amyloid precursor); SYUA_HUMAN; anti-SNCA antibody
Ordering
Host
Mouse
Reactivity
Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Rabbit, Dog
Clonality
Monoclonal
Isotype
Mouse IgG1
Specificity
Synuclein alpha Antibody detects endogenous levels of total Synuclein alpha.
Purity/Purification
Affinity-chromatography.
Form/Format
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Sequence
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Applicable Applications for anti-SNCA antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthesized peptide derived from human Synuclein alpha, corresponding to a region within C-terminal amino acids.
Conjugation
Unconjugated
Expression
Highly expressed in presynaptic terminals in the central nervous system. Expressed principally in brain.
Preparation and Storage
Store at -20 degree C. Stable for 12 months from date of receipt.

IHC (Immunohistochemisry)

(at 1/100 staining rat brain tissue by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-Mouse antibody was used as the secondary antibody.)

product-image-AAA330078_IHC11.jpg IHC (Immunohistochemisry) (at 1/100 staining rat brain tissue by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-Mouse antibody was used as the secondary antibody.)

IHC (Immunohiostchemistry)

(at 1/100 staining mouse brain tissue by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-Mouse antibody was used as the secondary antibody.)

product-image-AAA330078_IHC13.jpg IHC (Immunohiostchemistry) (at 1/100 staining mouse brain tissue by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-Mouse antibody was used as the secondary antibody.)

WB (Western Blot)

(Western blot analysis of extracts from mouse brain tissue using Synuclein alpha Antibody. The lane on the left was treated with blocking peptide.)

product-image-AAA330078_WB15.jpg WB (Western Blot) (Western blot analysis of extracts from mouse brain tissue using Synuclein alpha Antibody. The lane on the left was treated with blocking peptide.)
Related Product Information for anti-SNCA antibody
SNCA a member of the synuclein family. Abundantly expressed in the brain. Inhibits phospholipase D2 selectively. May integrate presynaptic signaling and membrane trafficking. Implicated in the pathogenesis of Parkinson's disease. A major component of amyloid plaques in the brains of patients with Alzheimer's disease. Two alternatively spliced isoforms transcripts have been identified.
Product Categories/Family for anti-SNCA antibody

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #
Molecular Weight
18kD; 14kD(Calculated)

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SNCA (Catalog #AAA330078) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Synuclein alpha Mouse Monoclonal Antibody reacts with Human, Mouse, Rat Prediction: Pig, Bovine, Horse, Rabbit, Dog and may cross-react with other species as described in the data sheet. AAA Biotech's Synuclein alpha can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the SNCA for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDVFMKGLSK AKEGVVAAAE KTKQGVAEAA GKTKEGVLYV GSKTKEGVVH GVATVAEKTK EQVTNVGGAV VTGVTAVAQK TVEGAGSIAA ATGFVKKDQL GKNEEGAPQE GILEDMPVDP DNEAYEMPSE EGYQDYEPEA. It is sometimes possible for the material contained within the vial of "Synuclein alpha, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.