Rabbit anti-Human T-bet/Tbx21 Monoclonal Antibody | anti-TBX21 antibody

T-bet/Tbx21 Rabbit PolymAb

Cat. Num. AAA28562

• Reactivity: Human
• Applications: Western Blot, Immunohistochemistry, Immunoprecipitation, ELISA
• Purity: Affinity purification
• Synonyms: T-bet/Tbx21, Antibody; T-bet/Tbx21 Rabbit PolymAb; TBET; IMD88; T-PET; T-bet; TBLYM; anti-TBX21 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG
• Purity/Purification: Affinity purification
• Form/Format: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
• Sequence: KGFRENFESMYTSVDTSIPSPPGPNCQFLGGDHYSPLLPNQYPVPSRFYPDLPGQAKDVVPQAYWLGAPRDHSYEAEFRAVSMKPAFLPSAPGPTMSYYRGQEVLAPGAGWPVAPQYPPKMGPASWFRPMRTLPMEPGPGGSEGRGPEDQGPPLVWTEIAPIRPESSDSGLGEGDSKRRRVSPYPSSGDSSSPAGAPSPFDKEAEGQFYNYFPN

• Applicable Applications for anti-TBX21 antibody: Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), Immunoprecipitation (IP), ELISA (EIA)
• Application Notes: WB: 1:1000-1:10000; IHC-P: 1:200-1:800; IP: 0.5ug-4ug antibody for 300ug-500ug extracts of whole cells; ELISA: Recommended starting concentration is 1ug/mL.; Please optimize the concentration based on your specific assay requirements.
• Cross Reactivity: Human, Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 322-535 of human T-bet/Tbx21(NP_037483.1).
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

IP (Immunoprecipitation)

(Immunoprecipitation of T-bet/Tbx21 from 400 µg extracts of NK-92 cells was performed using 1 µg of T-bet/Tbx21 Rabbit PolymAb (AAA28562). Rabbit IgG isotype control (AC042) was used to precipitate the Control IgG sample. IP samples were eluted with 1X reducing Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using T-bet/Tbx21 Rabbit PolymAb (AAA28562) at a dilution of 1:1000.)

IHC (Immunohistchemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat spleen tissue using T-bet/Tbx21 Rabbit PolymAb® (AAA28562) at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using T-bet/Tbx21 Rabbit PolymAb® (AAA28562) at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human anaplastic large cell lymphoma tissue using T-bet/Tbx21 Rabbit PolymAb® (AAA28562) at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human peripheral T-cell lymphoma tissue using T-bet/Tbx21 Rabbit PolymAb® (AAA28562) at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of lysates from Mouse thymus using T-bet/Tbx21 Rabbit PolymAb® (AAA28562) at 1:1000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 45s.)

WB (Western Blot)

(Western blot analysis of various lysates using T-bet/Tbx21 Rabbit PolymAb® (AAA28562)at 1:5000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Negative control (NC): U-937Exposure time: 10s.)

Related Product Information for anti-TBX21 antibody

This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is the human ortholog of mouse Tbx21/Tbet gene. Studies in mouse show that Tbx21 protein is a Th1 cell-specific transcription factor that controls the expression of the hallmark Th1 cytokine, interferon-gamma (IFNG). Expression of the human ortholog also correlates with IFNG expression in Th1 and natural killer cells, suggesting a role for this gene in initiating Th1 lineage development from naive Th precursor cells.

Product Categories/Family for anti-TBX21 antibody

Epigenetics Nuclear Signaling; Transcription Factors; Immunology Inflammation; Stem Cells; Hematopoietic Progenitors; Antibodies

NCBI and Uniprot Product Information

• NCBI GI #: 12230772
• NCBI GeneID: 30009
• UniProt Accession #: Q9UL17
• Molecular Weight: Calculated MW: 58kDa; Observed MW: 70kDa
• UniProt Protein Name: T-box transcription factor TBX21
• UniProt Gene Name: TBX21
• UniProt Synonym Gene Names: TBET; TBLYM; T-box protein 21
• UniProt Entry Name: TBX21_HUMAN