Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA28562_IP7.jpg IP (Immunoprecipitation) (Immunoprecipitation of T-bet/Tbx21 from 400 µg extracts of NK-92 cells was performed using 1 µg of T-bet/Tbx21 Rabbit PolymAb (AAA28562). Rabbit IgG isotype control (AC042) was used to precipitate the Control IgG sample. IP samples were eluted with 1X reducing Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using T-bet/Tbx21 Rabbit PolymAb (AAA28562) at a dilution of 1:1000.)

Rabbit anti-Human T-bet/Tbx21 Monoclonal Antibody | anti-TBX21 antibody

T-bet/Tbx21 Rabbit PolymAb

Reactivity
Human
Applications
Western Blot, Immunohistochemistry, Immunoprecipitation, ELISA
Purity
Affinity purification
Synonyms
T-bet/Tbx21, Antibody; T-bet/Tbx21 Rabbit PolymAb; TBET; IMD88; T-PET; T-bet; TBLYM; anti-TBX21 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
KGFRENFESMYTSVDTSIPSPPGPNCQFLGGDHYSPLLPNQYPVPSRFYPDLPGQAKDVVPQAYWLGAPRDHSYEAEFRAVSMKPAFLPSAPGPTMSYYRGQEVLAPGAGWPVAPQYPPKMGPASWFRPMRTLPMEPGPGGSEGRGPEDQGPPLVWTEIAPIRPESSDSGLGEGDSKRRRVSPYPSSGDSSSPAGAPSPFDKEAEGQFYNYFPN
Applicable Applications for anti-TBX21 antibody
WB (Western Blot), IHC (Immunohistochemistry), IP (Immunoprecipitation), ELISA
Application Notes
WB: 1:1000-1:10000
IHC-P: 1:200-1:800
IP: 0.5ug-4ug antibody for 300ug-500ug extracts of whole cells
ELISA: Recommended starting concentration is 1ug/mL.
Please optimize the concentration based on your specific assay requirements.
Cross Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 322-535 of human T-bet/Tbx21(NP_037483.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IP (Immunoprecipitation)

(Immunoprecipitation of T-bet/Tbx21 from 400 µg extracts of NK-92 cells was performed using 1 µg of T-bet/Tbx21 Rabbit PolymAb (AAA28562). Rabbit IgG isotype control (AC042) was used to precipitate the Control IgG sample. IP samples were eluted with 1X reducing Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using T-bet/Tbx21 Rabbit PolymAb (AAA28562) at a dilution of 1:1000.)

product-image-AAA28562_IP7.jpg IP (Immunoprecipitation) (Immunoprecipitation of T-bet/Tbx21 from 400 µg extracts of NK-92 cells was performed using 1 µg of T-bet/Tbx21 Rabbit PolymAb (AAA28562). Rabbit IgG isotype control (AC042) was used to precipitate the Control IgG sample. IP samples were eluted with 1X reducing Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using T-bet/Tbx21 Rabbit PolymAb (AAA28562) at a dilution of 1:1000.)

IHC (Immunohistchemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat spleen tissue using T-bet/Tbx21 Rabbit PolymAb® (AAA28562) at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)

product-image-AAA28562_IHC6.jpg IHC (Immunohistchemistry) (Immunohistochemistry analysis of paraffin-embedded Rat spleen tissue using T-bet/Tbx21 Rabbit PolymAb® (AAA28562) at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using T-bet/Tbx21 Rabbit PolymAb® (AAA28562) at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)

product-image-AAA28562_IHC5.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using T-bet/Tbx21 Rabbit PolymAb® (AAA28562) at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human anaplastic large cell lymphoma tissue using T-bet/Tbx21 Rabbit PolymAb® (AAA28562) at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)

product-image-AAA28562_IHC4.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human anaplastic large cell lymphoma tissue using T-bet/Tbx21 Rabbit PolymAb® (AAA28562) at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human peripheral T-cell lymphoma tissue using T-bet/Tbx21 Rabbit PolymAb® (AAA28562) at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)

product-image-AAA28562_IHC3.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human peripheral T-cell lymphoma tissue using T-bet/Tbx21 Rabbit PolymAb® (AAA28562) at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of lysates from Mouse thymus using T-bet/Tbx21 Rabbit PolymAb® (AAA28562) at 1:1000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 45s.)

product-image-AAA28562_WB2.jpg WB (Western Blot) (Western blot analysis of lysates from Mouse thymus using T-bet/Tbx21 Rabbit PolymAb® (AAA28562) at 1:1000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 45s.)

WB (Western Blot)

(Western blot analysis of various lysates using T-bet/Tbx21 Rabbit PolymAb® (AAA28562)at 1:5000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Negative control (NC): U-937Exposure time: 10s.)

product-image-AAA28562_WB.jpg WB (Western Blot) (Western blot analysis of various lysates using T-bet/Tbx21 Rabbit PolymAb® (AAA28562)at 1:5000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Negative control (NC): U-937Exposure time: 10s.)
Related Product Information for anti-TBX21 antibody
This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is the human ortholog of mouse Tbx21/Tbet gene. Studies in mouse show that Tbx21 protein is a Th1 cell-specific transcription factor that controls the expression of the hallmark Th1 cytokine, interferon-gamma (IFNG). Expression of the human ortholog also correlates with IFNG expression in Th1 and natural killer cells, suggesting a role for this gene in initiating Th1 lineage development from naive Th precursor cells.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
Calculated MW: 58kDa
Observed MW: 70kDa
UniProt Protein Name
T-box transcription factor TBX21
UniProt Gene Name
TBX21
UniProt Synonym Gene Names
TBET; TBLYM; T-box protein 21
UniProt Entry Name
TBX21_HUMAN

Similar Products

Product Notes

The TBX21 tbx21 (Catalog #AAA28562) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The T-bet/Tbx21 Rabbit PolymAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's T-bet/Tbx21 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry), IP (Immunoprecipitation), ELISA. WB: 1:1000-1:10000 IHC-P: 1:200-1:800 IP: 0.5ug-4ug antibody for 300ug-500ug extracts of whole cells ELISA: Recommended starting concentration is 1ug/mL. Please optimize the concentration based on your specific assay requirements. Researchers should empirically determine the suitability of the TBX21 tbx21 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: KGFRENFESM YTSVDTSIPS PPGPNCQFLG GDHYSPLLPN QYPVPSRFYP DLPGQAKDVV PQAYWLGAPR DHSYEAEFRA VSMKPAFLPS APGPTMSYYR GQEVLAPGAG WPVAPQYPPK MGPASWFRPM RTLPMEPGPG GSEGRGPEDQ GPPLVWTEIA PIRPESSDSG LGEGDSKRRR VSPYPSSGDS SSPAGAPSPF DKEAEGQFYN YFPN. It is sometimes possible for the material contained within the vial of "T-bet/Tbx21, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.