Mouse anti-Human TAF7 Monoclonal Antibody | anti-TAF7 antibody

TAF7 (TAF2F, TAFII55, Transcription Initiation Factor TFIID Subunit 7, RNA Polymerase II TBP-associated Factor Subunit F, Transcription Initiation Factor TFIID 55kD Subunit, TAF(II)55, TAFII-55) (Biotin)

Cat. Num. AAA24975

• Gene Names: TAF7; TAF2F; TAFII55
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TAF7, Antibody; TAF7 (TAF2F, TAFII55, Transcription Initiation Factor TFIID Subunit 7, RNA Polymerase II TBP-associated Factor Subunit F, Transcription Initiation Factor TFIID 55kD Subunit, TAF(II)55, TAFII-55) (Biotin); anti-TAF7 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2C5
• Specificity: Recognizes human TAF7.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-TAF7 antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa130-224 from human TAF7 (AAH32737) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: FIWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAENQGLDISSPGMSGHRQGHDSLEHDELREIFN
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(Western blot analysis of TAF7 over-expressed 293 cell line, cotransfected with TAF7 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TAF7 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Application Data

(Detection limit for recombinant GST tagged TAF7 is ~0.3ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to TAF7 on HeLa cell. [antibody concentration 10ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to TAF7 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to TAF7 on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3ug/ml])

WB (Western Blot)

(Western Blot analysis of TAF7 expression in transfected 293T cell line by TAF7 monoclonal antibody. Lane 1: TAF7 transfected lysate (40.3kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(TAF7 monoclonal antibody, Western Blot analysis of TAF7 expression in MCF-7.)

Product Categories/Family for anti-TAF7 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 22749797
• NCBI GeneID: 6879
• Molecular Weight: 40,259 Da
• NCBI Official Full Name: Homo sapiens TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa, mRNA
• NCBI Official Synonym Full Names: TATA-box binding protein associated factor 7
• NCBI Official Symbol: TAF7
• NCBI Official Synonym Symbols: TAF2F; TAFII55
• NCBI Protein Information: transcription initiation factor TFIID subunit 7