Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201799_WB10.jpg WB (Western Blot) (WB Suggested Anti-TAF7 Antibody Titration: 5.0-8.0ug/mlPositive Control: Jurkat cell lysateTAF7 is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit TAF7 Polyclonal Antibody | anti-TAF7 antibody

TAF7 antibody - N-terminal region

Gene Names
TAF7; TAF2F; TAFII55
Reactivity
Cow, Guinea Pig, Human, Mouse, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
TAF7, Antibody; TAF7 antibody - N-terminal region; anti-TAF7 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Guinea Pig, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MSKSKDDAPHELESQFILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPD
Sequence Length
349
Applicable Applications for anti-TAF7 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 92%; Rat: 100%; Zebrafish: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TAF7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-TAF7 Antibody Titration: 5.0-8.0ug/mlPositive Control: Jurkat cell lysateTAF7 is supported by BioGPS gene expression data to be expressed in Jurkat)

product-image-AAA201799_WB10.jpg WB (Western Blot) (WB Suggested Anti-TAF7 Antibody Titration: 5.0-8.0ug/mlPositive Control: Jurkat cell lysateTAF7 is supported by BioGPS gene expression data to be expressed in Jurkat)

IHC (Immunohistochemisry)

(Rabbit Anti-TAF7 antibodyParaffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA201799_IHC11.jpg IHC (Immunohistochemisry) (Rabbit Anti-TAF7 antibodyParaffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohiostchemistry)

(Human Lung)

product-image-AAA201799_IHC13.jpg IHC (Immunohiostchemistry) (Human Lung)

IHC (Immunohistochemistry)

(Human kidney)

product-image-AAA201799_IHC15.jpg IHC (Immunohistochemistry) (Human kidney)
Related Product Information for anti-TAF7 antibody
This is a rabbit polyclonal antibody against TAF7. It was validated on Western Blot and immunohistochemistry

Target Description: The intronless gene for this transcription coactivator is located between the protocadherin beta and gamma gene clusters on chromosome 5. The protein encoded by this gene is a component of the TFIID protein complex, a complex which binds to the TATA box in class II promoters and recruits RNA polymerase II and other factors. This particular subunit interacts with the largest TFIID subunit, as well as multiple transcription activators. The protein is required for transcription by promoters targeted by RNA polymerase II.
Product Categories/Family for anti-TAF7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
transcription initiation factor TFIID subunit 7
NCBI Official Synonym Full Names
TATA-box binding protein associated factor 7
NCBI Official Symbol
TAF7
NCBI Official Synonym Symbols
TAF2F; TAFII55
NCBI Protein Information
transcription initiation factor TFIID subunit 7
UniProt Protein Name
Transcription initiation factor TFIID subunit 7
UniProt Gene Name
TAF7
UniProt Synonym Gene Names
TAF2F; TAFII55; TAF(II)55; TAFII-55; TAFII55
UniProt Entry Name
TAF7_HUMAN

Similar Products

Product Notes

The TAF7 taf7 (Catalog #AAA201799) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TAF7 antibody - N-terminal region reacts with Cow, Guinea Pig, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TAF7 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the TAF7 taf7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MSKSKDDAPH ELESQFILRL PPEYASTVRR AVQSGHVNLK DRLTIELHPD. It is sometimes possible for the material contained within the vial of "TAF7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.