Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA19357_FCM6.png FCM (Flow Cytometry) (Figure 6. Flow Cytometry analysis of A549 cells using anti-TGFBR2 antibody (AAA19357).Overlay histogram showing A549 cells stained with AAA19357 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-TGFBR2 Antibody (AAA19357, 1μg/1x106 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-mouse IgG (BA1126, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

Mouse anti-Human TGFBR2 Monoclonal Antibody | anti-TGFBR2 antibody

Anti-TGFBR2 Antibody (monoclonal, 2F11)

Gene Names
TGFBR2; AAT3; FAA3; MFS2; RIIC; LDS1B; LDS2B; TAAD2; TGFR-2; TGFbeta-RII
Reactivity
Human
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Flow Cytometry, Functional Assay
Purity
Immunogen affinity purified.
Synonyms
TGFBR2, Antibody; Anti-TGFBR2 Antibody (monoclonal, 2F11); TGFBR2; TGF-beta receptor type-2; TGFR-2; EC 2. 7. 11. 30; TGF-beta type II receptor; Transforming growth factor-beta receptor type II; TGF-beta receptor type II; TbetaR-II; transforming growth factor, beta receptor II (70/80kDa); anti-TGFBR2 antibody
Ordering
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
Mouse IgG2b
Clone Number
2F11
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized. Each vial contains 4mg Trehalose, 0.9mg NaCl and 0.2mg Na2HPO4.
Applicable Applications for anti-TGFBR2 antibody
WB (Western Blot), IHC (Immunohistochemistry), ICC (Immunocytochemistry), IF (Immunofluorescence), FCM/FACS (Flow Cytometry)
Application Notes
WB: Concentration: 0.25-0.5ug/ml ; Tested Species: Human
IHC-P: Concentration: 2-5ug/ml ; Tested Species: Human
ICC/IF: Concentration: 5ug/ml; Tested Species: Human
FC: Concentration: 1-3ug/1x106cells ; Tested Species: Human


Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human TGFBR2 (96-128aa TLETVCHDPKLPYHDFILEDAASPKCIMKEKKK), different from the related mouse sequence by five amino acids, and from the related rat sequence by eight amino acids.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Relevant Detection Systems
Lab recommends Enhanced Chemiluminescent Kit with anti-Mouse IgG ( ) for Western blot, and HRP Conjugated anti-Mouse IgG Super Vision Assay Kit ( ) for IHC(P) and ICC.
Preparation and Storage
Store at -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

FCM (Flow Cytometry)

(Figure 6. Flow Cytometry analysis of A549 cells using anti-TGFBR2 antibody (AAA19357).Overlay histogram showing A549 cells stained with AAA19357 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-TGFBR2 Antibody (AAA19357, 1μg/1x106 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-mouse IgG (BA1126, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA19357_FCM6.png FCM (Flow Cytometry) (Figure 6. Flow Cytometry analysis of A549 cells using anti-TGFBR2 antibody (AAA19357).Overlay histogram showing A549 cells stained with AAA19357 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-TGFBR2 Antibody (AAA19357, 1μg/1x106 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-mouse IgG (BA1126, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

IF (Immunofluorescence)

(Figure 5. IF analysis of TGFBR2 using anti- TGFBR2 antibody (M00179-1).TGFBR2 was detected in immunocytochemical section of HepG2 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 5μg/mL mouse anti- TGFBR2 Antibody (M00179-1) overnight at 4 degree C. DyLight®488 Conjugated Goat Anti-Mouse IgG (BA1126) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37 degree C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.)

product-image-AAA19357_IF5.jpg IF (Immunofluorescence) (Figure 5. IF analysis of TGFBR2 using anti- TGFBR2 antibody (M00179-1).TGFBR2 was detected in immunocytochemical section of HepG2 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 5μg/mL mouse anti- TGFBR2 Antibody (M00179-1) overnight at 4 degree C. DyLight®488 Conjugated Goat Anti-Mouse IgG (BA1126) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37 degree C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.)

IHC (Immunohistochemistry)

(Figure 4. IHC analysis of TGFBR2 using anti-TGFBR2 antibody (AAA19357).TGFBR2 was detected in paraffin-embedded section of human esophageal squamous carcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml mouse anti-TGFBR2 Antibody (AAA19357) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

product-image-AAA19357_IHC4.jpg IHC (Immunohistochemistry) (Figure 4. IHC analysis of TGFBR2 using anti-TGFBR2 antibody (AAA19357).TGFBR2 was detected in paraffin-embedded section of human esophageal squamous carcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml mouse anti-TGFBR2 Antibody (AAA19357) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 3. IHC analysis of TGFBR2 using anti-TGFBR2 antibody (AAA19357).TGFBR2 was detected in paraffin-embedded section of human cervical intraepithelial neoplasia tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml mouse anti-TGFBR2 Antibody (AAA19357) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

product-image-AAA19357_IHC3.jpg IHC (Immunohistochemistry) (Figure 3. IHC analysis of TGFBR2 using anti-TGFBR2 antibody (AAA19357).TGFBR2 was detected in paraffin-embedded section of human cervical intraepithelial neoplasia tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml mouse anti-TGFBR2 Antibody (AAA19357) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 2. IHC analysis of TGFBR2 using anti-TGFBR2 antibody (AAA19357).TGFBR2 was detected in paraffin-embedded section of human placenta tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml mouse anti-TGFBR2 Antibody (AAA19357) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

product-image-AAA19357_IHC2.jpg IHC (Immunohistochemistry) (Figure 2. IHC analysis of TGFBR2 using anti-TGFBR2 antibody (AAA19357).TGFBR2 was detected in paraffin-embedded section of human placenta tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml mouse anti-TGFBR2 Antibody (AAA19357) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

WB (Western Blot)

(Figure 1. Western blot analysis of TGFBR2 using anti-TGFBR2 antibody (AAA19357).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30ug of sample under reducing conditions.Lane 1: human HepG2 whole cell lysatesLane 2: human A549 whole cell lysatesLane 3: human K562 whole cell lysatesLane 4: human Caco-2 whole cell lysatesLane 5: human Hela whole cell lysatesLane 6: human T-47D whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1. 5 hour at RT. The membrane was incubated with mouse anti- TGFBR2 antigen affinity purified monoclonal antibody (Catalog # AAA19357) at 0. 5 μg/mL overnight at 4 degree C, then washed with TBS-0. 1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1. 5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # with Tanon 5200 system. A specific band was detected for TGFBR2 at approximately 70-85KD. The expected band size for TGFBR2 is at 70-85KD.)

product-image-AAA19357_WB.jpg WB (Western Blot) (Figure 1. Western blot analysis of TGFBR2 using anti-TGFBR2 antibody (AAA19357).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30ug of sample under reducing conditions.Lane 1: human HepG2 whole cell lysatesLane 2: human A549 whole cell lysatesLane 3: human K562 whole cell lysatesLane 4: human Caco-2 whole cell lysatesLane 5: human Hela whole cell lysatesLane 6: human T-47D whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1. 5 hour at RT. The membrane was incubated with mouse anti- TGFBR2 antigen affinity purified monoclonal antibody (Catalog # AAA19357) at 0. 5 μg/mL overnight at 4 degree C, then washed with TBS-0. 1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1. 5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # with Tanon 5200 system. A specific band was detected for TGFBR2 at approximately 70-85KD. The expected band size for TGFBR2 is at 70-85KD.)
Related Product Information for anti-TGFBR2 antibody
TGFBR2 (transforming growth factor, beta receptor II (70/80kDa)), also known as TGF-beta receptor type-2, TGFR-2, TGF-beta type II receptor, Transforming growth factor-beta receptor type II(TGF-beta receptor type II, TbetaR-II), is a member of the Ser/Thr protein kinase family and the TGFB receptor subfamily. A TGFBR2 cDNA encodes a deduced 565-amino acid protein with a calculated molecular mass of approximately 60 kD in length. The encoded protein is a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with another receptor protein, and binds TGF-beta. This receptor/ligand complex phosphorylates proteins, which then enter the nucleus and regulate the transcription of a subset of genes related to cell proliferation. Mutations in this gene have been associated with Marfan syndrome, Loeys-Deitz aortic aneurysm syndrome, Osler-Weber-Rendu syndrome, and the development of various types of tumors. Alternatively spliced transcript variants encoding different informs have been characterized.
References
1. Hagen, G., Muller, S., Beato, M., Suske, G. Cloning by recognition site screening of two novel GT box binding proteins: a family of Sp1 related genes. Nucleic Acids Res. 20: 5519-5525, 1992.
2. Lin, H. Y., Wang, X. -F., Ng-Eaton, E., Weinberg, R. A., Lodish, H. F. Expression cloning of the TGF-beta type II receptor, a functional transmembrane serine/threonine kinase. Cell 68: 775-785, 1992.
3. Hahm, K. -B., Cho, K., Lee, C., Im, Y. -H., Chang, J., Choi, S. -G., Sorensen, P. H. B., Thiele, C. J., Kim, S. -J. Repression of the gene encoding the TGF-beta type II receptor is a major target of the EWS-FLI1 oncoprotein. Nature Genet. 23: 222-227, 1999.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
TGF-beta receptor type-2 isoform A
NCBI Official Synonym Full Names
transforming growth factor, beta receptor II (70/80kDa)
NCBI Official Symbol
TGFBR2
NCBI Official Synonym Symbols
AAT3; FAA3; MFS2; RIIC; LDS1B; LDS2B; TAAD2; TGFR-2; TGFbeta-RII
NCBI Protein Information
TGF-beta receptor type-2; tbetaR-II; TGF-beta type II receptor; TGF-beta receptor type IIB; transforming growth factor beta receptor type IIC
UniProt Protein Name
TGF-beta receptor type-2
UniProt Gene Name
TGFBR2
UniProt Synonym Gene Names
TGFR-2; TGF-beta receptor type II; TbetaR-II
UniProt Entry Name
TGFR2_HUMAN

Similar Products

Product Notes

The TGFBR2 tgfbr2 (Catalog #AAA19357) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Anti-TGFBR2 Antibody (monoclonal, 2F11) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TGFBR2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry), ICC (Immunocytochemistry), IF (Immunofluorescence), FCM/FACS (Flow Cytometry). WB: Concentration: 0.25-0.5ug/ml ; Tested Species: Human IHC-P: Concentration: 2-5ug/ml ; Tested Species: Human ICC/IF: Concentration: 5ug/ml; Tested Species: Human FC: Concentration: 1-3ug/1x106cells ; Tested Species: Human Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Researchers should empirically determine the suitability of the TGFBR2 tgfbr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TGFBR2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.