Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199480_WB13.jpg WB (Western Blot) (WB Suggested Anti-TGFBR2 Antibody Titration: 5.0ug/mlPositive Control: HepG2 cell lysateTGFBR2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

Rabbit TGFBR2 Polyclonal Antibody | anti-TGFBR2 antibody

TGFBR2 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
TGFBR2; AAT3; FAA3; LDS2; MFS2; RIIC; LDS1B; LDS2B; TAAD2; TBRII; TBR-ii; TGFR-2; TGFbeta-RII
Reactivity
Cow, Goat, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Protein A purified
Synonyms
TGFBR2, Antibody; TGFBR2 antibody - N-terminal region; anti-TGFBR2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Goat, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSDVEMEAQKDEIICPSCNRT
Sequence Length
567
Applicable Applications for anti-TGFBR2 antibody
WB (Western Blot)
Homology
Cow: 93%; Goat: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 100%; Rat: 93%; Sheep: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TGFBR2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-TGFBR2 Antibody Titration: 5.0ug/mlPositive Control: HepG2 cell lysateTGFBR2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

product-image-AAA199480_WB13.jpg WB (Western Blot) (WB Suggested Anti-TGFBR2 Antibody Titration: 5.0ug/mlPositive Control: HepG2 cell lysateTGFBR2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

WB (Western Blot)

(Host: MouseTarget Name: TGFBR2Sample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

product-image-AAA199480_WB15.jpg WB (Western Blot) (Host: MouseTarget Name: TGFBR2Sample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)
Related Product Information for anti-TGFBR2 antibody
This is a rabbit polyclonal antibody against TGFBR2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TGFBR2 is a member of the Ser/Thr protein kinase family and the TGFB receptor subfamily. The protein is a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with another receptor protein, and binds TGF-beta. This receptor/ligand complex phosphorylates proteins, which then enter the nucleus and regulate the transcription of a subset of genes related to cell proliferation. Mutations in its gene have been associated with Marfan Syndrome, Loeys-Deitz Aortic Aneurysm Syndrome, and the development of various types of tumors.This gene is a member of the Ser/Thr protein kinase family and the TGFB receptor subfamily. It encodes a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with another receptor protein and binds TGF-beta. This receptor/ligand complex phosphorylates proteins which then enter the nucleus and regulate the transcription of a subset of genes related to cell proliferation. Mutations in this gene have been associated with Marfan Syndrome, Loeys-Deitz Aortic Aneurysm Syndrome, and the development of various types of tumors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62kDa
NCBI Official Full Name
TGF-beta receptor type-2 isoform B
NCBI Official Synonym Full Names
transforming growth factor beta receptor 2
NCBI Official Symbol
TGFBR2
NCBI Official Synonym Symbols
AAT3; FAA3; LDS2; MFS2; RIIC; LDS1B; LDS2B; TAAD2; TBRII; TBR-ii; TGFR-2; TGFbeta-RII
NCBI Protein Information
TGF-beta receptor type-2
UniProt Protein Name
TGF-beta receptor type-2
UniProt Gene Name
TGFBR2
UniProt Synonym Gene Names
TGFR-2; TGF-beta receptor type II; TbetaR-II
UniProt Entry Name
TGFR2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The TGFBR2 tgfbr2 (Catalog #AAA199480) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TGFBR2 antibody - N-terminal region reacts with Cow, Goat, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's TGFBR2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the TGFBR2 tgfbr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MGRGLLRGLW PLHIVLWTRI ASTIPPHVQK SDVEMEAQKD EIICPSCNRT. It is sometimes possible for the material contained within the vial of "TGFBR2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.