Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA25567_WB7.jpg WB (Western Blot) (TGIF2 monoclonal antibody, Western Blot analysis of TGIF2 expression in HeLa NE.)

Mouse anti-Human TGIF2 Monoclonal Antibody | anti-TGIF2 antibody

TGIF2 (TGF-beta-induced Transcription Factor 2, TGFB-induced Factor 2, Homeobox Protein TGIF2, 5'-TG-3'-interacting Factor 2) (HRP)

Average rating 0.0
No ratings yet
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TGIF2, Antibody; TGIF2 (TGF-beta-induced Transcription Factor 2, TGFB-induced Factor 2, Homeobox Protein TGIF2, 5'-TG-3'-interacting Factor 2) (HRP); anti-TGIF2 antibody
Ordering
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4C10
Specificity
Recognizes human TGIF2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-TGIF2 antibody
ELISA, WB (Western Blot)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa131-237 from human TGIF2 (NP_068581) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SMPLHSGQGEKPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKEDFSSFQLLVEVALQRAAEMELQKQQDPSLPLLHTPIPLVSENP
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(TGIF2 monoclonal antibody, Western Blot analysis of TGIF2 expression in HeLa NE.)

product-image-AAA25567_WB7.jpg WB (Western Blot) (TGIF2 monoclonal antibody, Western Blot analysis of TGIF2 expression in HeLa NE.)

WB (Western Blot)

(TGIF2 monoclonal antibody. Western Blot analysis of TGIF2 expression in SW-13.)

product-image-AAA25567_WB6.jpg WB (Western Blot) (TGIF2 monoclonal antibody. Western Blot analysis of TGIF2 expression in SW-13.)

WB (Western Blot)

(Western blot analysis of TGIF2 over-expressed 293 cell line, cotransfected with TGIF2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TGIF2 monoclonal antibody (M01). GAPDH (36.1kD). used as specificity and loading control.)

product-image-AAA25567_WB5.jpg WB (Western Blot) (Western blot analysis of TGIF2 over-expressed 293 cell line, cotransfected with TGIF2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TGIF2 monoclonal antibody (M01). GAPDH (36.1kD). used as specificity and loading control.)

Application Data

(Detection limit for recombinant GST tagged TGIF2 is ~0.3ng/ml as a capture antibody.)

product-image-AAA25567_APP4.jpg Application Data (Detection limit for recombinant GST tagged TGIF2 is ~0.3ng/ml as a capture antibody.)

WB (Western Blot)

(Western Blot analysis of TGIF2 expression in transfected 293T cell line by TGIF2 monoclonal antibody. Lane 1: TGIF2 transfected lysate (25.9kD). Lane 2: Non-transfected lysate.)

product-image-AAA25567_WB3.jpg WB (Western Blot) (Western Blot analysis of TGIF2 expression in transfected 293T cell line by TGIF2 monoclonal antibody. Lane 1: TGIF2 transfected lysate (25.9kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(TGIF2 monoclonal antibody. Western Blot analysis of TGIF2 expression in IMR-32.)

product-image-AAA25567_WB2.jpg WB (Western Blot) (TGIF2 monoclonal antibody. Western Blot analysis of TGIF2 expression in IMR-32.)

WB (Western Blot)

(Western Blot detection against Immunogen (37.77kD).)

product-image-AAA25567_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (37.77kD).)
Product Categories/Family for anti-TGIF2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
17,908 Da
NCBI Official Full Name
homeobox protein TGIF2
NCBI Official Synonym Full Names
TGFB-induced factor homeobox 2
NCBI Official Symbol
TGIF2
NCBI Protein Information
homeobox protein TGIF2

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The TGIF2 (Catalog #AAA25567) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TGIF2 (TGF-beta-induced Transcription Factor 2, TGFB-induced Factor 2, Homeobox Protein TGIF2, 5'-TG-3'-interacting Factor 2) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TGIF2 can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TGIF2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TGIF2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.