Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA24685_APP6.jpg Application Data (Detection limit for recombinant GST tagged TP53 is approximately 3ng/ml as a capture antibody.)

Mouse anti-Human TP53 Monoclonal Antibody | anti-TP53 antibody

TP53 (Tumor Suppressor p53, Cellular Tumor Antigen p53, TRP53, Antigen NY-CO-13, BCC7, LFS1, Phosphoprotein p53) APC

Average rating 0.0
No ratings yet
Gene Names
TP53; P53; BCC7; LFS1; TRP53
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TP53, Antibody; TP53 (Tumor Suppressor p53, Cellular Tumor Antigen p53, TRP53, Antigen NY-CO-13, BCC7, LFS1, Phosphoprotein p53) APC; anti-TP53 antibody
Ordering
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2C11
Specificity
Recognizes human TP53.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-TP53 antibody
ELISA, IHC (Immunohistochemistry), WB (Western Blot)
Application Notes
IHC-P: 6ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa94-201 from human TP53 (AAH03596) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNL
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Application Data

(Detection limit for recombinant GST tagged TP53 is approximately 3ng/ml as a capture antibody.)

product-image-AAA24685_APP6.jpg Application Data (Detection limit for recombinant GST tagged TP53 is approximately 3ng/ml as a capture antibody.)

WB (Western Blot)

(TP53 monoclonal antibody, Western Blot analysis of TP53 expression in A-431.)

product-image-AAA24685_WB5.jpg WB (Western Blot) (TP53 monoclonal antibody, Western Blot analysis of TP53 expression in A-431.)

WB (Western Blot)

(Western Blot detection against Immunogen (37.62kD.)

product-image-AAA24685_WB4.jpg WB (Western Blot) (Western Blot detection against Immunogen (37.62kD.)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to TP53 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 6ug/ml])

product-image-AAA24685_IHC3.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to TP53 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 6ug/ml])

Application Data

(Proximity Ligation Analysis of protein-protein interactions between TP53 and BAX. HeLa cells were stained with TP53 rabbit purified polyclonal 1:1200 and BAX mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

product-image-AAA24685_APP2.jpg Application Data (Proximity Ligation Analysis of protein-protein interactions between TP53 and BAX. HeLa cells were stained with TP53 rabbit purified polyclonal 1:1200 and BAX mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

WB (Western Blot)

(Western Blot analysis of TP53 expression in transfected 293T cell line by TP53 monoclonal antibody. Lane 1: TP53 transfected lysate (43.34kD) Lane 2: Non-transfected lysate.)

product-image-AAA24685_WB.jpg WB (Western Blot) (Western Blot analysis of TP53 expression in transfected 293T cell line by TP53 monoclonal antibody. Lane 1: TP53 transfected lysate (43.34kD) Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-TP53 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
24,401 Da
NCBI Official Full Name
Homo sapiens tumor protein p53, mRNA
NCBI Official Synonym Full Names
tumor protein p53
NCBI Official Symbol
TP53
NCBI Official Synonym Symbols
P53; BCC7; LFS1; TRP53
NCBI Protein Information
cellular tumor antigen p53
UniProt Protein Name
Cellular tumor antigen p53
UniProt Gene Name
TP53
UniProt Synonym Gene Names
P53
UniProt Entry Name
P53_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The TP53 tp53 (Catalog #AAA24685) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TP53 (Tumor Suppressor p53, Cellular Tumor Antigen p53, TRP53, Antigen NY-CO-13, BCC7, LFS1, Phosphoprotein p53) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TP53 can be used in a range of immunoassay formats including, but not limited to, ELISA, IHC (Immunohistochemistry), WB (Western Blot). IHC-P: 6ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TP53 tp53 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TP53, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.