Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA330091_IF10.jpg IF (Immunofluorescence) (AAA330091 staining HepG2 cells by IF/ICC. The samples were fixed with PFA and permeabilized in 0.1% Triton X-100, then blocked in 10% serum for 45 minutes at 25 degree C. Samples were then incubated with primary Ab(#AAA330091) and rabbit anti-beta tubulin Ab for 1 hour at 37 degree C. An AlexaFluor594 conjugated goat anti-mouse IgG Ab(Red) and an AlexaFluor488 conjugated goat anti-rabbit IgG Ab(Green) were used as the secondary antibody. The nuclear counter stain is DAPI (blue).)

Mouse TRIM59 Monoclonal Antibody | anti-TRIM59 antibody

TRIM59 Mouse Monoclonal Antibody

Reactivity
Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Dog
Applications
Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity-chromatography.
Synonyms
TRIM59, Antibody; TRIM59 Mouse Monoclonal Antibody; 2310035M22Rik; 2700022F13Rik; MGC129860; MGC129861; MGC26631; MRF1; RING finger protein 104; RNF104; TRI59_HUMAN; TRIM57; TRIM59; Tripartite motif containing 57; tripartite motif containing 59; Tripartite motif-containing protein 59; TSBF1; Tumor suppressor TSBF 1; Tumor suppressor TSBF-1; anti-TRIM59 antibody
Ordering
Host
Mouse
Reactivity
Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Dog
Clonality
Monoclonal
Isotype
Mouse IgG1
Specificity
TRIM59 Antibody detects endogenous levels of total TRIM59.
Purity/Purification
Affinity-chromatography.
Form/Format
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Sequence
MHNFEEELTCPICYSIFEDPRVLPCSHTFCRNCLENILQASGNFYIWRPLRIPLKCPNCRSITEIAPTGIESLPVNFALRAIIEKYQQEDHPDIVTCPEHYRQPLNVYCLLDKKLVCGHCLTIGQHHGHPIDDLQSAYLKEKDTPQKLLEQLTDTHWTDLTHLIEKLKEQKSHSEKMIQGDKEAVLQYFKELNDTLEQKKKSFLTALCDVGNLINQEYTPQIERMKEIREQQLELMALTISLQEESPLKFLEKVDDVRQHVQILKQRPLPEVQPVEIYPRVSKILKEEWSRTEIGQIKNVLIPKMKISPKRMSCSWPGKDEKEVEFLKILNIVVVTLISVILMSILFFNQHIITFLSEITLIWFSEASLSVYQSLSNSLHKVKNILCHIFYLLKEFVWKIVSH
Applicable Applications for anti-TRIM59 antibody
ICC (Immunocytochemistry), IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthesized peptide derived from human TRIM59(Accession Q8IWR1), corresponding to amino acid residues I214-L235.
Conjugation
Unconjugated
Preparation and Storage
Store at -20 degree C. Stable for 12 months from date of receipt.

IF (Immunofluorescence)

(AAA330091 staining HepG2 cells by IF/ICC. The samples were fixed with PFA and permeabilized in 0.1% Triton X-100, then blocked in 10% serum for 45 minutes at 25 degree C. Samples were then incubated with primary Ab(#AAA330091) and rabbit anti-beta tubulin Ab for 1 hour at 37 degree C. An AlexaFluor594 conjugated goat anti-mouse IgG Ab(Red) and an AlexaFluor488 conjugated goat anti-rabbit IgG Ab(Green) were used as the secondary antibody. The nuclear counter stain is DAPI (blue).)

product-image-AAA330091_IF10.jpg IF (Immunofluorescence) (AAA330091 staining HepG2 cells by IF/ICC. The samples were fixed with PFA and permeabilized in 0.1% Triton X-100, then blocked in 10% serum for 45 minutes at 25 degree C. Samples were then incubated with primary Ab(#AAA330091) and rabbit anti-beta tubulin Ab for 1 hour at 37 degree C. An AlexaFluor594 conjugated goat anti-mouse IgG Ab(Red) and an AlexaFluor488 conjugated goat anti-rabbit IgG Ab(Green) were used as the secondary antibody. The nuclear counter stain is DAPI (blue).)

IHC (Immunohistochemisry)

(AAA330091 at 1/100 staining aaaaaa by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-mouse antibody was used as the secondary antibody.)

product-image-AAA330091_IHC11.jpg IHC (Immunohistochemisry) (AAA330091 at 1/100 staining aaaaaa by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-mouse antibody was used as the secondary antibody.)

IHC (Immunohiostchemistry)

(AAA330091 at 1/100 staining human ovarian cancer by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-mouse antibody was used as the secondary antibody.)

product-image-AAA330091_IHC13.jpg IHC (Immunohiostchemistry) (AAA330091 at 1/100 staining human ovarian cancer by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-mouse antibody was used as the secondary antibody.)

WB (Western Blot)

(Western blot analysis of extracts from mouse muscle tissue, using TRIM59 Mouse Monoclonal Antibody. The lane on the left was treated with blocking peptide.)

product-image-AAA330091_WB15.jpg WB (Western Blot) (Western blot analysis of extracts from mouse muscle tissue, using TRIM59 Mouse Monoclonal Antibody. The lane on the left was treated with blocking peptide.)
Product Categories/Family for anti-TRIM59 antibody

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #
Molecular Weight
47 kD; 47kD(Calculated)

Similar Products

Product Notes

The TRIM59 (Catalog #AAA330091) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TRIM59 Mouse Monoclonal Antibody reacts with Human, Mouse, Rat Prediction: Pig, Bovine, Horse, Dog and may cross-react with other species as described in the data sheet. AAA Biotech's TRIM59 can be used in a range of immunoassay formats including, but not limited to, ICC (Immunocytochemistry), IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the TRIM59 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MHNFEEELTC PICYSIFEDP RVLPCSHTFC RNCLENILQA SGNFYIWRPL RIPLKCPNCR SITEIAPTGI ESLPVNFALR AIIEKYQQED HPDIVTCPEH YRQPLNVYCL LDKKLVCGHC LTIGQHHGHP IDDLQSAYLK EKDTPQKLLE QLTDTHWTDL THLIEKLKEQ KSHSEKMIQG DKEAVLQYFK ELNDTLEQKK KSFLTALCDV GNLINQEYTP QIERMKEIRE QQLELMALTI SLQEESPLKF LEKVDDVRQH VQILKQRPLP EVQPVEIYPR VSKILKEEWS RTEIGQIKNV LIPKMKISPK RMSCSWPGKD EKEVEFLKIL NIVVVTLISV ILMSILFFNQ HIITFLSEIT LIWFSEASLS VYQSLSNSLH KVKNILCHIF YLLKEFVWKI VSH. It is sometimes possible for the material contained within the vial of "TRIM59, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.