Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA28571_ChIP10.jpg ChIP (Chromatin Immunoprecipitation) (Chromatin immunoprecipitation was performed with 10 ug of cross-linked chromatin from HeLa, using 2 ug of TriMethyl-Histone H3-K27 Rabbit PolymAb® (AAA28571) and Rabbit Control IgG (AC005). The enrichment of immunoprecipitated DNA at different genomic loci was examined by quantitative PCR. The histogram compares the ratio of the immunoprecipitated DNA to the input at given loci.)

Rabbit anti-Human TriMethyl-Histone H3-K27 Monoclonal Antibody | anti-H3C1/H3-4 antibody

TriMethyl-Histone H3-K27 Rabbit PolymAb

Reactivity
Human
Applications
Western Blot, Dot Blot, Immunohistochemistry, Immunofluorescence, Immunocytochemistry, ELISA, Chromatin Immunoprecipitation, Immunoprecipitation
Purity
Affinity purification
Synonyms
TriMethyl-Histone H3-K27, Antibody; TriMethyl-Histone H3-K27 Rabbit PolymAb; H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; TriMethyl-Histone H3-K27; anti-H3C1/H3-4 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
Applicable Applications for anti-H3C1/H3-4 antibody
WB (Western Blot), DB (Dot Blot), IHC (Immunohistochemistry), IF (Immunofluorescence), ICC (Immunocytochemistry), ELISA, ChIP (Chromatin Immunoprecipitation)
Application Notes
WB: 1:500-1:1000
DB: 1:500-1:1000
IHC-P: 1:50-1:200
IF/ICC: 1:50-1:200
ELISA: Recommended starting concentration is 1ug/mL.
Please optimize the concentration based on your specific assay requirements.
ChIP: 2 ug antibody for 5ug-10ug of Chromatin
Cross Reactivity
Human, Mouse, Rat, Other (Wide Range Predicted)
Immunogen
A synthetic trimethylated peptide around K27 of human Histone H3 (NP_003520.1).
Modification
TriMethyl
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

ChIP (Chromatin Immunoprecipitation)

(Chromatin immunoprecipitation was performed with 10 ug of cross-linked chromatin from HeLa, using 2 ug of TriMethyl-Histone H3-K27 Rabbit PolymAb® (AAA28571) and Rabbit Control IgG (AC005). The enrichment of immunoprecipitated DNA at different genomic loci was examined by quantitative PCR. The histogram compares the ratio of the immunoprecipitated DNA to the input at given loci.)

product-image-AAA28571_ChIP10.jpg ChIP (Chromatin Immunoprecipitation) (Chromatin immunoprecipitation was performed with 10 ug of cross-linked chromatin from HeLa, using 2 ug of TriMethyl-Histone H3-K27 Rabbit PolymAb® (AAA28571) and Rabbit Control IgG (AC005). The enrichment of immunoprecipitated DNA at different genomic loci was examined by quantitative PCR. The histogram compares the ratio of the immunoprecipitated DNA to the input at given loci.)

ICC (Immunocytochemistry)

(Confocal imaging of C6 cells using TriMethyl-Histone H3-K27 Rabbit PolymAb® (AAA28571, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.)

product-image-AAA28571_ICC9.jpg ICC (Immunocytochemistry) (Confocal imaging of C6 cells using TriMethyl-Histone H3-K27 Rabbit PolymAb® (AAA28571, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.)

ICC (Immunocytochemistry)

(Confocal imaging of HeLa cells using TriMethyl-Histone H3-K27 Rabbit PolymAb® (AAA28571, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.)

product-image-AAA28571_ICC8.jpg ICC (Immunocytochemistry) (Confocal imaging of HeLa cells using TriMethyl-Histone H3-K27 Rabbit PolymAb® (AAA28571, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human breast tissue using TriMethyl-Histone H3-K27 Rabbit PolymAb® (AAA28571) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.)

product-image-AAA28571_IHC7.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human breast tissue using TriMethyl-Histone H3-K27 Rabbit PolymAb® (AAA28571) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.)

IHC (Immunohistchemistry)

(Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using TriMethyl-Histone H3-K27 Rabbit PolymAb® (AAA28571) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.)

product-image-AAA28571_IHC6.jpg IHC (Immunohistchemistry) (Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using TriMethyl-Histone H3-K27 Rabbit PolymAb® (AAA28571) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using TriMethyl-Histone H3-K27 Rabbit PolymAb® (AAA28571) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.)

product-image-AAA28571_IHC5.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using TriMethyl-Histone H3-K27 Rabbit PolymAb® (AAA28571) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using TriMethyl-Histone H3-K27 Rabbit PolymAb® (AAA28571) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.)

product-image-AAA28571_IHC4.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using TriMethyl-Histone H3-K27 Rabbit PolymAb® (AAA28571) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using TriMethyl-Histone H3-K27 Rabbit PolymAb® (AAA28571) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.)

product-image-AAA28571_IHC3.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using TriMethyl-Histone H3-K27 Rabbit PolymAb® (AAA28571) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of various lysates using TriMethyl-Histone H3-K27 Rabbit PolymAb® (AAA28571)at 1:1000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Negative control (NC): H3 prokaryotic proteinExposure time: 5s.)

product-image-AAA28571_WB2.jpg WB (Western Blot) (Western blot analysis of various lysates using TriMethyl-Histone H3-K27 Rabbit PolymAb® (AAA28571)at 1:1000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Negative control (NC): H3 prokaryotic proteinExposure time: 5s.)

DB (Dot Blot)

(Dot-blot analysis of H3K9me0, H3K9me1, H3K9me2, H3K9me3, H3K14me0, H3K14me1, H3K14me2, H3K14me3, H3K27me0, H3K27me1, H3K27me2, H3K27me3?H3K36me0, H3K36me1, H3K36me2, H3K36me3?H3K79me0, H3K79me1, H3K79me2, H3K79me3 using TriMethyl-Histone H3-K27 Rabbit PolymAb® .)

product-image-AAA28571_DB.jpg DB (Dot Blot) (Dot-blot analysis of H3K9me0, H3K9me1, H3K9me2, H3K9me3, H3K14me0, H3K14me1, H3K14me2, H3K14me3, H3K27me0, H3K27me1, H3K27me2, H3K27me3?H3K36me0, H3K36me1, H3K36me2, H3K36me3?H3K79me0, H3K79me1, H3K79me2, H3K79me3 using TriMethyl-Histone H3-K27 Rabbit PolymAb® .)
Related Product Information for anti-H3C1/H3-4 antibody
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is located separately from the other H3 genes that are in the histone gene cluster on chromosome 6p22-p21.3.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 16kDa
Observed MW: 17kDa
UniProt Protein Name
Histone H3.1t
UniProt Gene Name
HIST3H3
UniProt Synonym Gene Names
H3FT; H3/t; H3t
UniProt Entry Name
H31T_HUMAN

Similar Products

Product Notes

The H3C1/H3-4 hist3h3 (Catalog #AAA28571) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TriMethyl-Histone H3-K27 Rabbit PolymAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TriMethyl-Histone H3-K27 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), DB (Dot Blot), IHC (Immunohistochemistry), IF (Immunofluorescence), ICC (Immunocytochemistry), ELISA, ChIP (Chromatin Immunoprecipitation). WB: 1:500-1:1000 DB: 1:500-1:1000 IHC-P: 1:50-1:200 IF/ICC: 1:50-1:200 ELISA: Recommended starting concentration is 1ug/mL. Please optimize the concentration based on your specific assay requirements. ChIP: 2 ug antibody for 5ug-10ug of Chromatin. Researchers should empirically determine the suitability of the H3C1/H3-4 hist3h3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MARTKQTARK STGGKAPRKQ LATKAARKSA PATGGVKKPH RYRPGTVALR EIRRYQKSTE LLIRKLPFQR LVREIAQDFK TDLRFQSSAV MALQEACEAY. It is sometimes possible for the material contained within the vial of "TriMethyl-Histone H3-K27, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.