Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA28417_ChIP9.jpg ChIP (Chromatin Immunoprecipitation) (Chromatin immunoprecipitation analysis of extracts of HeLa; cells, using TriMethyl-Histone H3-K27 Mouse mAb antibody and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.)

Mouse TriMethyl-Histone H3-K27 Polyclonal Antibody | anti-H3-K27 antibody

TriMethyl-Histone H3-K27 Mouse mAb

Gene Names
ANK3; MRT37; ANKYRIN-G
Reactivity
Human, Mouse, Rat, Other (Wide Range)
Applications
Western Blot, Immunohistochemistry, Immunofluorescence, Immunocytochemistry, Immunoprecipitation, Chromatin Immunoprecipitation, Immunoprecipitation
Purity
Affinity purification
Synonyms
TriMethyl-Histone H3-K27, Antibody; TriMethyl-Histone H3-K27 Mouse mAb; H3.4; H3/g; H3FT; H3t; HIST3H3; Histone H3; HIST1H3A; anti-H3-K27 antibody
Ordering
Host
Mouse
Reactivity
Human, Mouse, Rat, Other (Wide Range)
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.01% thiomersal, 50% glycerol, pH7.3.
Sequence
KMNVPETMNEVLDMSDDEVRKANAPEMLSDGEYISDVEEGEDAMTGDTDKYLGPQDLKELGDDSLPAEGYMGFSLGARSASLRSFSSDRSYTLNRSSYARDSMMIEELLVPSKEQHLTFTREFDSDSLRHYSWAADTLDNVNLVS
Applicable Applications for anti-H3-K27 antibody
WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence), ICC (Immunocytochemistry), IP (Immunoprecipitation), ChIP (Chromatin Immunoprecipitation)
Application Notes
WB: 1:500-1:2000
IHC 1:50-1:200
IF/ICC: 1:50-1:200
IP: 1:50-1:200
ChIP: 1:20-1:100
CUT&Tag: 10? cells /1 ug
Customer Validation: WB (Mus musculus, Sus scrofa, Homo sapiens)
CHIP (Oryza sativa)
IF (Mus musculus)
ChIP (Oryza sativa)
Positive Samples
HeLa, NIH/3T3, C6, H3 protein
Immunogen
A synthetic methylated peptide corresponding to residues surrounding K27 of human histone H3
Cellular Location
Chromosome, Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

ChIP (Chromatin Immunoprecipitation)

(Chromatin immunoprecipitation analysis of extracts of HeLa; cells, using TriMethyl-Histone H3-K27 Mouse mAb antibody and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.)

product-image-AAA28417_ChIP9.jpg ChIP (Chromatin Immunoprecipitation) (Chromatin immunoprecipitation analysis of extracts of HeLa; cells, using TriMethyl-Histone H3-K27 Mouse mAb antibody and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.)

IF (Immunofluorescence)

(Immunofluorescence analysis of U-2OS cells using TriMethyl-Histone H3-K27 antibody at dilution of 1:25. Blue: DAPI for nuclear staining.)

product-image-AAA28417_IF8.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U-2OS cells using TriMethyl-Histone H3-K27 antibody at dilution of 1:25. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of NIH/3T3 cells using TriMethyl-Histone H3-K27 antibody at dilution of 1:25. Blue: DAPI for nuclear staining.)

product-image-AAA28417_IF7.jpg IF (Immunofluorescence) (Immunofluorescence analysis of NIH/3T3 cells using TriMethyl-Histone H3-K27 antibody at dilution of 1:25. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of C6 cells using TriMethyl-Histone H3-K27 antibody at dilution of 1:25. Blue: DAPI for nuclear staining.)

product-image-AAA28417_IF6.jpg IF (Immunofluorescence) (Immunofluorescence analysis of C6 cells using TriMethyl-Histone H3-K27 antibody at dilution of 1:25. Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded rat brain using TriMethyl-Histone H3-K27 antibody at dilution of 1:25 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

product-image-AAA28417_IHC5.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded rat brain using TriMethyl-Histone H3-K27 antibody at dilution of 1:25 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse brain using TriMethyl-Histone H3-K27 antibody at dilution of 1:25 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

product-image-AAA28417_IHC4.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse brain using TriMethyl-Histone H3-K27 antibody at dilution of 1:25 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human colon carcinoma using TriMethyl-Histone H3-K27 antibody at dilution of 1:25 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

product-image-AAA28417_IHC3.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human colon carcinoma using TriMethyl-Histone H3-K27 antibody at dilution of 1:25 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

DB (Dot Blot)

(Dot-blot analysis of all sorts of methylation peptides using TriMethyl-Histone H3-K27 antibody at 1:1000 dilution.)

product-image-AAA28417_DB2.jpg DB (Dot Blot) (Dot-blot analysis of all sorts of methylation peptides using TriMethyl-Histone H3-K27 antibody at 1:1000 dilution.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using TriMethyl-Histone H3-K27 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Mouse IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.)

product-image-AAA28417_WB.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using TriMethyl-Histone H3-K27 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Mouse IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.)
Related Product Information for anti-H3-K27 antibody
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is located separately from the other H3 genes that are in the histone gene cluster on chromosome 6p22-p21.3.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
288
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
160,947 Da
NCBI Official Full Name
ankyrin-3 isoform 2
NCBI Official Synonym Full Names
ankyrin 3, node of Ranvier (ankyrin G)
NCBI Official Symbol
ANK3
NCBI Official Synonym Symbols
MRT37; ANKYRIN-G
NCBI Protein Information
ankyrin-3; ankyrin G119
UniProt Protein Name
Ankyrin-3
UniProt Gene Name
ANK3
UniProt Synonym Gene Names
ANK-3
UniProt Entry Name
ANK3_HUMAN

Similar Products

Product Notes

The H3-K27 ank3 (Catalog #AAA28417) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TriMethyl-Histone H3-K27 Mouse mAb reacts with Human, Mouse, Rat, Other (Wide Range) and may cross-react with other species as described in the data sheet. AAA Biotech's TriMethyl-Histone H3-K27 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence), ICC (Immunocytochemistry), IP (Immunoprecipitation), ChIP (Chromatin Immunoprecipitation). WB: 1:500-1:2000 IHC 1:50-1:200 IF/ICC: 1:50-1:200 IP: 1:50-1:200 ChIP: 1:20-1:100 CUT&Tag: 10? cells /1 ug Customer Validation: WB (Mus musculus, Sus scrofa, Homo sapiens) CHIP (Oryza sativa) IF (Mus musculus) ChIP (Oryza sativa). Researchers should empirically determine the suitability of the H3-K27 ank3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: KMNVPETMNE VLDMSDDEVR KANAPEMLSD GEYISDVEEG EDAMTGDTDK YLGPQDLKEL GDDSLPAEGY MGFSLGARSA SLRSFSSDRS YTLNRSSYAR DSMMIEELLV PSKEQHLTFT REFDSDSLRH YSWAADTLDN VNLVS. It is sometimes possible for the material contained within the vial of "TriMethyl-Histone H3-K27, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.