Mouse Tubulin beta-2A Chain Monoclonal Antibody | anti-TUBB2A antibody

Tubulin beta-2A Chain (Tubulin beta Class IIa, TUBB2A, TUBB2, TUBB, dJ40E16.7) APC

Cat. Num. AAA24692

• Gene Names: TUBB2A; TUBB; TUBB2; CDCBM5
• Reactivity: Human, Mouse, Rat
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Tubulin beta-2A Chain, Antibody; Tubulin beta-2A Chain (Tubulin beta Class IIa, TUBB2A, TUBB2, TUBB, dJ40E16.7) APC; TUBB 2; Tubulin beta 2A; TUBB 2A; TUBB 2C; TUBB2C; anti-TUBB2A antibody

• Host: Mouse
• Reactivity: Human, Mouse, Rat
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2B2
• Specificity: Recognizes human TUBB2A. Species Crossreactivity: mouse and rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-TUBB2A antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 1.5ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full-length recombinant corresponding to aa1-445 from human TUBB2A (AAH01194) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNTNDLVSEYQQYQDATADEQGEFEEEEGEDEA
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(Western Blot analysis of TUBB2A expression in transfected 293T cell line by TUBB2A monoclonal antibody. Lane 1: TUBB2A transfected lysate (49.9kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(TUBB2A monoclonal antibody. Western Blot analysis of TUBB2A expression in NIH/3T3.)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to TUBB2A on formalin-fixed paraffin-embedded human spleen. [antibody concentration 1.5ug/ml])

WB (Western Blot)

(TUBB2A monoclonal antibody. Western Blot analysis of TUBB2A expression in Jurkat.)

WB (Western Blot)

(TUBB2A monoclonal antibody. Western Blot analysis of TUBB2A expression in Raw 264.7.)

WB (Western Blot)

(TUBB2A monoclonal antibody. Western Blot analysis of TUBB2A expression in PC-12.)

WB (Western Blot)

(Western Blot detection against Immunogen (74.47kD).)

Product Categories/Family for anti-TUBB2A antibody

Antibodies; Tubulin

NCBI and Uniprot Product Information

• NCBI GI #: 12654708
• NCBI GeneID: 7280
• Molecular Weight: 49,907 Da
• NCBI Official Full Name: Homo sapiens tubulin, beta 2A, mRNA
• NCBI Official Synonym Full Names: tubulin beta 2A class IIa
• NCBI Official Symbol: TUBB2A
• NCBI Official Synonym Symbols: TUBB; TUBB2; CDCBM5
• NCBI Protein Information: tubulin beta-2A chain