Loading...

Skip to main content

Call us at +1-800-604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

IHC (Immunohistchemistry) (AAA31474 at 1/100 staining rat testis tissue by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-mouse antibody was used as the secondary antibody.)

Mouse Ubiquitin Monoclonal Antibody | anti-UBA52 antibody

Ubiquitin Mouse Monoclonal Antibody

Reactivity
Human, Mouse, Rat
Prediction: Pig, Zebrafish, Bovine, Horse, Sheep, Dog, Chicken, Xenopus
Applications
Western Blot, Immunohistochemistry, Immunofluorescence, Immunocytochemistry, ELISA
Purity
Affinity-chromatography.
Synonyms
Ubiquitin, Antibody; Ubiquitin Mouse Monoclonal Antibody; 60S ribosomal protein L40; CEP52; HUBCEP52; L40; MGC126879; MGC57125; RPL40; UBA 52; Ubiquitin 52 amino acid fusion protein; Ubiquitin 60S ribosomal protein L40; Ubiquitin A 52 residue ribosomal protein fusion product 1; Ubiquitin carboxyl extension protein 52; Ubiquitin CEP52; UBA52; anti-UBA52 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Prediction: Pig, Zebrafish, Bovine, Horse, Sheep, Dog, Chicken, Xenopus
Clonality
Monoclonal
Isotype
Mouse IgG1
Specificity
Ubiquitin Antibody detects endogenous levels of total Ubiquitin.
Purity/Purification
Affinity-chromatography.
Form/Format
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLHPRAVNCRKKKCGHTNNLRPKKKVK
Applicable Applications for anti-UBA52 antibody
Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Immunocytochemistry (ICC), ELISA (EIA)(peptide)
Application Notes
IHC: 1:50-1:200
WB: 1:500-1:2000
IF/ICC: 1:100-1:500
Immunogen
A synthesized peptide derived from human Ubiquitin.
Conjugation
Unconjugated
Preparation and Storage
Store at -20 degree C. Stable for 12 months from date of receipt.

IHC (Immunohistchemistry)

(AAA31474 at 1/100 staining rat testis tissue by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-mouse antibody was used as the secondary antibody.)

IHC (Immunohistchemistry) (AAA31474 at 1/100 staining rat testis tissue by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-mouse antibody was used as the secondary antibody.)

IHC (Immunohistochemistry)

(AAA31474 at 1/100 staining rat heart tissue by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-mouse antibody was used as the secondary antibody.)

IHC (Immunohistochemistry) (AAA31474 at 1/100 staining rat heart tissue by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-mouse antibody was used as the secondary antibody.)

IHC (Immunohistochemistry)

(AAA31474 at 1/100 staining mouse testis tissue by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-mouse antibody was used as the secondary antibody.)

IHC (Immunohistochemistry) (AAA31474 at 1/100 staining mouse testis tissue by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-mouse antibody was used as the secondary antibody.)

IHC (Immunohistochemistry)

(AAA31474 at 1/100 staining aaaaaa by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-mouse antibody was used as the secondary antibody.)

IHC (Immunohistochemistry) (AAA31474 at 1/100 staining aaaaaa by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-mouse antibody was used as the secondary antibody.)

IHC (Immunohistochemistry)

(AAA31474 at 1/100 staining human colorectal cancer by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-mouse antibody was used as the secondary antibody.)

IHC (Immunohistochemistry) (AAA31474 at 1/100 staining human colorectal cancer by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-mouse antibody was used as the secondary antibody.)

WB (Western Blot)

(Western blot analysis of extracts from various samples, using Annexin A2 Mouse Monoclonal Antibody. Lane 1: 293 cells treated with blocking peptide; Lane 2: 293 cells; Lane 3: mouse kidney tissue. Lane 4: rat heart tissue.)

WB (Western Blot) (Western blot analysis of extracts from various samples, using Annexin A2 Mouse Monoclonal Antibody. Lane 1: 293 cells treated with blocking peptide; Lane 2: 293 cells; Lane 3: mouse kidney tissue. Lane 4: rat heart tissue.)
Product Categories/Family for anti-UBA52 antibody

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #
Molecular Weight
8kD,16kD,24kD,32kD; 15kD(Calculated)

Similar Products

Product Notes

The UBA52 (Catalog #AAA31474) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Ubiquitin Mouse Monoclonal Antibody reacts with Human, Mouse, Rat Prediction: Pig, Zebrafish, Bovine, Horse, Sheep, Dog, Chicken, Xenopus and may cross-react with other species as described in the data sheet. AAA Biotech's Ubiquitin can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Immunocytochemistry (ICC), ELISA (EIA)(peptide). IHC: 1:50-1:200 WB: 1:500-1:2000 IF/ICC: 1:100-1:500. Researchers should empirically determine the suitability of the UBA52 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MQIFVKTLTG KTITLEVEPS DTIENVKAKI QDKEGIPPDQ QRLIFAGKQL EDGRTLSDYN IQKESTLHLV LRLRGGIIEP SLRQLAQKYN CDKMICRKCY ARLHPRAVNC RKKKCGHTNN LRPKKKVK. It is sometimes possible for the material contained within the vial of "Ubiquitin, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.