Loading...

Skip to main content
Application Data (Detection limit for recombinant GST tagged UBTF is approximately 1ng/ml as a capture antibody.)

Mouse UBTF Monoclonal Antibody | anti-UBTF antibody

UBTF (Upstream Binding Transcription Factor, RNA Polymerase I, NOR-90, UBF) (FITC)

Gene Names
UBTF; UBF; UBF1; UBF2; UBF-1; CONDBA; NOR-90
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
UBTF, Antibody; UBTF (Upstream Binding Transcription Factor, RNA Polymerase I, NOR-90, UBF) (FITC); Upstream Binding Transcription Factor; RNA Polymerase I; NOR-90; UBF; anti-UBTF antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2D8
Specificity
Recognizes UBTF.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-UBTF antibody
Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
UBTF (NP_055048, 551aa-650aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PPAATNSSKKMKFQGEPKKPPMNGYQKFSQELLSNGELNHLPLKERMVEIGSRWQRISQSQKEHYKKLAEEQQKQYKVHLDLWVKSLSPQDRAAYKEYIS
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Application Data

(Detection limit for recombinant GST tagged UBTF is approximately 1ng/ml as a capture antibody.)

Application Data (Detection limit for recombinant GST tagged UBTF is approximately 1ng/ml as a capture antibody.)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to UBTF on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml])

IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to UBTF on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to UBTF on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml])

IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to UBTF on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml])

WB (Western Blot)

(UBTF monoclonal antibody (M04), clone 2D8 Western Blot analysis of UBTF expression in HepG2 (Cat # L019V1).)

WB (Western Blot) (UBTF monoclonal antibody (M04), clone 2D8 Western Blot analysis of UBTF expression in HepG2 (Cat # L019V1).)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to UBTF on HepG2 cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to UBTF on HepG2 cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to UBTF on HepG2 cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to UBTF on HepG2 cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-UBTF antibody
Upstream binding factor (UBF) is a transcription factor required for expression of the 18S, 5.8S, and 28S ribosomal RNAs, along with SL1 (a complex of TBP (MIM 600075) and multiple TBP-associated factors or 'TAFs'). Two UBF polypeptides, of 94 and 97 kD, exist in the human (Bell et al., 1988 [PubMed 3413483]). UBF is a nucleolar phosphoprotein with both DNA binding and transactivation domains. Sequence-specific DNA binding to the core and upstream control elements of the human rRNA promoter is mediated through several HMG boxes (Jantzen et al., 1990 [PubMed 2330041]). [supplied by OMIM]
Product Categories/Family for anti-UBTF antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
89kDa
NCBI Official Full Name
nucleolar transcription factor 1 isoform a
NCBI Official Synonym Full Names
upstream binding transcription factor
NCBI Official Symbol
UBTF
NCBI Official Synonym Symbols
UBF; UBF1; UBF2; UBF-1; CONDBA; NOR-90
NCBI Protein Information
nucleolar transcription factor 1
UniProt Protein Name
Nucleolar transcription factor 1
UniProt Gene Name
UBTF
UniProt Synonym Gene Names
UBF; UBF1; UBF-1
UniProt Entry Name
UBF1_HUMAN

Similar Products

Product Notes

The UBTF ubtf (Catalog #AAA26370) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's UBTF can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the UBTF ubtf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "UBTF, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.