Loading...

Skip to main content
SDS-PAGE

Tetanus toxin (tetX) Recombinant Protein | tetX recombinant protein

Recombinant Clostridium tetani Tetanus toxin (tetX), partial

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Tetanus toxin (tetX); N/A; Recombinant Clostridium tetani Tetanus toxin (tetX), partial; Tentoxylysin; tetX recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-457aa; Partial, provide Tetanus toxin light chain
Sequence
PITINNFRYSDPVNNDTIIMMEPPYCKGLDIYYKAFKITDRIWIVPERYEFGTKPEDFNPPSSLIEGASEYYDPNYLRTDSDKDRFLQTMVKLFNRIKNNVAGEALLDKIINAIPYLGNSYSLLDKFDTNSNSVSFNLLEQDPSGATTKSAMLTNLIIFGPGPVLNKNEVRGIVLRVDNKNYFPCRDGFGSIMQMAFCPEYVPTFDNVIENITSLTIGKSKYFQDPALLLMHELIHVLHGLYGMQVSSHEIIPSKQEIYMQHTYPISAEELFTFGGQDANLISIDIKNDLYEKTLNDYKAIANKLSQVTSCNDPNIDIDSYKQIYQQKYQFDKDSNGQYIVNEDKFQILYNSIMYGFTEIELGKKFNIKTRLSYFSMNHDPVKIPNLLDDTIYNDTEGFNIESKDLKSEYKGQNMRVNTNAFRNVDGSGLVSKLIGLCKKIIPPTNIRENLYNRTA
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for tetX recombinant protein
Tetanus toxin acts by inhibiting neurotransmitter release. It binds to peripheral neuronal synapses, is internalized and moves by retrograde transport up the axon into the spinal cord where it can move between postsynaptic and presynaptic neurons. It inhibits neurotransmitter release by acting as a zinc endopeptidase that catalyzes the hydrolysis of the '76-Gln-|-Phe-77' bond of synaptobrevin-2.
References
Tetanus toxin primary structure, expression in E. coli, and homology with botulinum toxins.Eisel U., Jarausch W., Goretzki K., Henschen A., Engels J., Weller U., Hudel M., Habermann E., Niemann H.EMBO J. 5:2495-2502(1986) The complete nucleotide sequence of tetanus toxin.Fairweather N.F., Lyness V.A.Nucleic Acids Res. 14:7809-7812(1986) The genome sequence of Clostridium tetani, the causative agent of tetanus disease.Brueggemann H., Baeumer S., Fricke W.F., Wiezer A., Liesegang H., Decker I., Herzberg C., Martinez-Arias R., Merkl R., Henne A., Gottschalk G.Proc. Natl. Acad. Sci. U.S.A. 100:1316-1321(2003) Cloning, nucleotide sequencing, and expression of tetanus toxin fragment C in Escherichia coli.Fairweather N.F., Lyness V.A., Pickard D.J., Allen G., Thomson R.O.J. Bacteriol. 165:21-27(1986) Arrangement of disulfide bridges and positions of sulfhydryl groups in tetanus toxin.Krieglstein K., Henschen A., Weller U., Habermann E.Eur. J. Biochem. 188:39-45(1990) Limited proteolysis of tetanus toxin. Relation to activity and identification of cleavage sites.Krieglstein K.G., Henschen A.H., Weller U., Habermann E.Eur. J. Biochem. 202:41-51(1991) Tetanus toxin is a zinc protein and its inhibition of neurotransmitter release and protease activity depend on zinc.Schiavo G., Poulain B., Rossetto O., Benfenati F., Tauc L., Montecucco C.EMBO J. 11:3577-3583(1992) Tetanus and botulinum-B neurotoxins block neurotransmitter release by proteolytic cleavage of synaptobrevin.Schiavo G., Benfenati F., Poulain B., Rossetto O., de Laureto P.P., Dasgupta B.R., Montecucco C.Nature 359:832-835(1992) Structure of the receptor binding fragment HC of tetanus neurotoxin.Umland T.C., Wingert L.M., Swaminathan S., Furey W.F. Jr., Schmidt J.J., Sax M.Nat. Struct. Biol. 4:788-792(1997)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
66.3 kDa
NCBI Official Full Name
tetanus toxin
NCBI Official Symbol
CTC_RS14060
NCBI Protein Information
tetanus toxin
UniProt Protein Name
Tetanus toxin
UniProt Gene Name
tetX
UniProt Synonym Gene Names
Tetanus toxin chain L; Tetanus toxin chain H
UniProt Entry Name
TETX_CLOTE

Similar Products

Product Notes

The tetX tetx (Catalog #AAA18711) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-457aa; Partial, provide Tetanus toxin light chain. The amino acid sequence is listed below: PITINNFRYS DPVNNDTIIM MEPPYCKGLD IYYKAFKITD RIWIVPERYE FGTKPEDFNP PSSLIEGASE YYDPNYLRTD SDKDRFLQTM VKLFNRIKNN VAGEALLDKI INAIPYLGNS YSLLDKFDTN SNSVSFNLLE QDPSGATTKS AMLTNLIIFG PGPVLNKNEV RGIVLRVDNK NYFPCRDGFG SIMQMAFCPE YVPTFDNVIE NITSLTIGKS KYFQDPALLL MHELIHVLHG LYGMQVSSHE IIPSKQEIYM QHTYPISAEE LFTFGGQDAN LISIDIKNDL YEKTLNDYKA IANKLSQVTS CNDPNIDIDS YKQIYQQKYQ FDKDSNGQYI VNEDKFQILY NSIMYGFTEI ELGKKFNIKT RLSYFSMNHD PVKIPNLLDD TIYNDTEGFN IESKDLKSEY KGQNMRVNTN AFRNVDGSGL VSKLIGLCKK IIPPTNIREN LYNRTA . It is sometimes possible for the material contained within the vial of "Tetanus toxin (tetX), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.