Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA19673_FCM9.png FCM (Flow Cytometry) (Figure 9. Flow Cytometry analysis of A431 cells using anti-YY1 antibody (AAA19673).Overlay histogram showing A431 cells stained with AAA19673 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-YY1 Antibody (AAA19673, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-mouse IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

Mouse YY1 Monoclonal Antibody | anti-YY1 antibody

Anti-YY1 Antibody Picoband (monoclonal, 3F3E7)

Average rating 0.0
No ratings yet
Gene Names
YY1; DELTA; NF-E1; UCRBP; INO80S; YIN-YANG-1
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Flow Cytometry, Functional Assay
Purity
Immunogen affinity purified.
Synonyms
YY1, Antibody; Anti-YY1 Antibody Picoband (monoclonal, 3F3E7); anti-YY1 antibody
Ordering
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
Mouse IgG1
Clone Number
3F3E7
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.
Concentration
Adding 0.2 ml of distilled water will yield a concentration of 500 ug/ml. (varies by lot)
Applicable Applications for anti-YY1 antibody
WB (Western Blot), IHC (Immunohistochemistry), ICC (Immunocytochemistry), IF (Immunofluorescence), FCM/FACS (Flow Cytometry)
Application Notes
WB: 0.25-0.5 ug/ml, Human, Mouse, Rat
IHC-P: 2-5 ug/ml, Human
ICC/IF: 5 ug/ml, Human
FC/FACS: 1-3 ug/1x10^6 cells, Human
Tested Species: In-house tested species with positive results.
Enhanced Chemiluminescent Kit with anti-Mouse IgG for Western blot, and HRP Conjugated anti-Mouse IgG Super Vision Assay Kit for IHC(P) and ICC.
Reconstitution
Adding 0.2 ml of distilled water will yield a concentration of 500 ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human YY1 (206-241aa EQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEEQ), identical to the related mouse sequence.
Preparation and Storage
Store at -20 degree C for one year from date of receipt. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for six months. Avoid repeated freezing and thawing.

FCM (Flow Cytometry)

(Figure 9. Flow Cytometry analysis of A431 cells using anti-YY1 antibody (AAA19673).Overlay histogram showing A431 cells stained with AAA19673 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-YY1 Antibody (AAA19673, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-mouse IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA19673_FCM9.png FCM (Flow Cytometry) (Figure 9. Flow Cytometry analysis of A431 cells using anti-YY1 antibody (AAA19673).Overlay histogram showing A431 cells stained with AAA19673 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-YY1 Antibody (AAA19673, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-mouse IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

IF (Immunofluorescence)

(Figure 8. IF analysis of YY1 using anti-YY1 antibody (M00179-1).YY1 was detected in an immunocytochemical section of T-47D cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 5 ug/mL mouse anti-YY1 Antibody (M00179-1) overnight at 4 degree C. DyLight594 Conjugated Goat Anti-Mouse IgG (BA1141) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37 degree C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.)

product-image-AAA19673_IF8.jpg IF (Immunofluorescence) (Figure 8. IF analysis of YY1 using anti-YY1 antibody (M00179-1).YY1 was detected in an immunocytochemical section of T-47D cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 5 ug/mL mouse anti-YY1 Antibody (M00179-1) overnight at 4 degree C. DyLight594 Conjugated Goat Anti-Mouse IgG (BA1141) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37 degree C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.)

IHC (Immunohistochemistry)

(Figure 7. IHC analysis of YY1 using anti-YY1 antibody (AAA19673).YY1 was detected in a paraffin-embedded section of human the muscular layer of a colonic adenocarcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-YY1 Antibody (AAA19673) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

product-image-AAA19673_IHC7.jpg IHC (Immunohistochemistry) (Figure 7. IHC analysis of YY1 using anti-YY1 antibody (AAA19673).YY1 was detected in a paraffin-embedded section of human the muscular layer of a colonic adenocarcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-YY1 Antibody (AAA19673) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

IHC (Immunohistchemistry)

(Figure 6. IHC analysis of YY1 using anti-YY1 antibody (AAA19673).YY1 was detected in a paraffin-embedded section of human serous adenocarcinoma of ovary tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-YY1 Antibody (AAA19673) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

product-image-AAA19673_IHC6.jpg IHC (Immunohistchemistry) (Figure 6. IHC analysis of YY1 using anti-YY1 antibody (AAA19673).YY1 was detected in a paraffin-embedded section of human serous adenocarcinoma of ovary tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-YY1 Antibody (AAA19673) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 5. IHC analysis of YY1 using anti-YY1 antibody (AAA19673).YY1 was detected in a paraffin-embedded section of human pancreatic ductal adenocarcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-YY1 Antibody (AAA19673) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

product-image-AAA19673_IHC5.jpg IHC (Immunohistochemistry) (Figure 5. IHC analysis of YY1 using anti-YY1 antibody (AAA19673).YY1 was detected in a paraffin-embedded section of human pancreatic ductal adenocarcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-YY1 Antibody (AAA19673) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 4. IHC analysis of YY1 using anti-YY1 antibody (AAA19673).YY1 was detected in a paraffin-embedded section of human ovarian serous cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-YY1 Antibody (AAA19673) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

product-image-AAA19673_IHC4.jpg IHC (Immunohistochemistry) (Figure 4. IHC analysis of YY1 using anti-YY1 antibody (AAA19673).YY1 was detected in a paraffin-embedded section of human ovarian serous cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-YY1 Antibody (AAA19673) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 3. IHC analysis of YY1 using anti-YY1 antibody (AAA19673).YY1 was detected in a paraffin-embedded section of human laryngeal squamous cell carcinomas tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-YY1 Antibody (AAA19673) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

product-image-AAA19673_IHC3.jpg IHC (Immunohistochemistry) (Figure 3. IHC analysis of YY1 using anti-YY1 antibody (AAA19673).YY1 was detected in a paraffin-embedded section of human laryngeal squamous cell carcinomas tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-YY1 Antibody (AAA19673) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 2. IHC analysis of YY1 using anti-YY1 antibody (AAA19673).YY1 was detected in a paraffin-embedded section of human thyroid cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-YY1 Antibody (AAA19673) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

product-image-AAA19673_IHC2.jpg IHC (Immunohistochemistry) (Figure 2. IHC analysis of YY1 using anti-YY1 antibody (AAA19673).YY1 was detected in a paraffin-embedded section of human thyroid cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-YY1 Antibody (AAA19673) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

WB (Western Blot)

(Figure 1. Western blot analysis of YY1 using anti-YY1 antibody (AAA19673).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.Lane 1: human Caco-2 whole cell lysates,Lane 2: human SW620 whole cell lysates,Lane 3: human MDA-MB-453 lysates,Lane 4: human PC-3 whole cell lysates,Lane 5: rat thymus tissue lysates,Lane 6: mouse thymus tissue lysates.After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-YY1 antigen affinity purified monoclonal antibody (#AAA19673) at 0.5 ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for YY1 at approximately 65 kDa. The expected band size for YY1 is at 65 kDa.)

product-image-AAA19673_WB.jpg WB (Western Blot) (Figure 1. Western blot analysis of YY1 using anti-YY1 antibody (AAA19673).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.Lane 1: human Caco-2 whole cell lysates,Lane 2: human SW620 whole cell lysates,Lane 3: human MDA-MB-453 lysates,Lane 4: human PC-3 whole cell lysates,Lane 5: rat thymus tissue lysates,Lane 6: mouse thymus tissue lysates.After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-YY1 antigen affinity purified monoclonal antibody (#AAA19673) at 0.5 ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for YY1 at approximately 65 kDa. The expected band size for YY1 is at 65 kDa.)
Related Product Information for anti-YY1 antibody
YY1 (Yin Yang 1) is a transcriptional repressor protein in humans that is encoded by the YY1 gene. YY1 is a ubiquitously distributed transcription factor belonging to the GLI-Kruppel class of zinc finger proteins. The protein is involved in repressing and activating a diverse number of promoters. YY1 may direct histone deacetylases and histone acetyltransferases to a promoter in order to activate or repress the promoter, thus implicating histone modification in the function of YY1.
Product Categories/Family for anti-YY1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44,713 Da
NCBI Official Full Name
Homo sapiens YY1 transcription factor (YY1), mRNA
NCBI Official Synonym Full Names
YY1 transcription factor
NCBI Official Symbol
YY1
NCBI Official Synonym Symbols
DELTA; NF-E1; UCRBP; INO80S; YIN-YANG-1
NCBI Protein Information
transcriptional repressor protein YY1; INO80 complex subunit S; YY-1; Yin and Yang 1 protein; delta transcription factor
UniProt Protein Name
Transcriptional repressor protein YY1
UniProt Gene Name
YY1
UniProt Synonym Gene Names
INO80S; YY-1
UniProt Entry Name
TYY1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The YY1 yy1 (Catalog #AAA19673) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Anti-YY1 Antibody Picoband (monoclonal, 3F3E7) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's YY1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry), ICC (Immunocytochemistry), IF (Immunofluorescence), FCM/FACS (Flow Cytometry). WB: 0.25-0.5 ug/ml, Human, Mouse, Rat IHC-P: 2-5 ug/ml, Human ICC/IF: 5 ug/ml, Human FC/FACS: 1-3 ug/1x10^6 cells, Human Tested Species: In-house tested species with positive results. Enhanced Chemiluminescent Kit with anti-Mouse IgG for Western blot, and HRP Conjugated anti-Mouse IgG Super Vision Assay Kit for IHC(P) and ICC. Researchers should empirically determine the suitability of the YY1 yy1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "YY1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.