Melatonin Receptor 1A (MTNR1A) Recombinant Protein | MTNR1A recombinant protein
Recombinant Melatonin Receptor 1A (MTNR1A)
Gene Names
Mtnr1a; MR; MelR
Applications
Immunoprecipitation, ELISA, Western Blot, SDS-Page
Purity
> 95%
Synonyms
Melatonin Receptor 1A (MTNR1A); N/A; Recombinant Melatonin Receptor 1A (MTNR1A); MTNR1A recombinant protein
Host
E Coli
Purity/Purification
> 95%
Form/Format
Supplied as lyophilized form in PBS,pH7.4, containing 5% sucrose, 0.01% sarcosyl.
Sequence
The target protein is fused with two N-terminal Tags, His-tag and S-tag, its sequence is listed below.
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-L LNQNFRKEYK KIIVSLCTAK MFFVESSNEE ADKIKCKPSP LIPNNNLIKV DSV
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-L LNQNFRKEYK KIIVSLCTAK MFFVESSNEE ADKIKCKPSP LIPNNNLIKV DSV
Sequence Length
353
Applicable Applications for MTNR1A recombinant protein
IP (Immunoprecipitation), ELISA, WB (Western Blot), SDS-PAGE
Organism
Mus musculus (Mouse)
Expression System
Prokaryotic expression
Residues
Leu300~Val353 (Accession # Q61184) with two N-terminal Tags, His-tag and S-tag
Endotoxin Level
<1.0EU per 1ug (determined by the LAL method)
Reconstitution
Reconstitute in sterile PBS, pH7.2-pH7.4.
Preparation and Storage
Avoid repeated freeze/thaw cycles. Store at 2-8 degree C for one month. Aliquot and store at -80 degree C for 12 months.
Stability Test: The thermal stability is described by the loss rate of the targetprotein. The loss rate was determined by accelerated thermal degradation test,that is, incubate the protein at 37 degree C for 48h, and no obvious degradation andprecipitation were observed. (Referring from China Biological Products Standard,which was calculated by the Arrhenius equation.) The loss of this protein is lessthan 5% within the expiration date under appropriate storage condition.
Stability Test: The thermal stability is described by the loss rate of the targetprotein. The loss rate was determined by accelerated thermal degradation test,that is, incubate the protein at 37 degree C for 48h, and no obvious degradation andprecipitation were observed. (Referring from China Biological Products Standard,which was calculated by the Arrhenius equation.) The loss of this protein is lessthan 5% within the expiration date under appropriate storage condition.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11.9kDa
NCBI Official Full Name
melatonin receptor type 1A
NCBI Official Synonym Full Names
melatonin receptor 1A
NCBI Official Symbol
Mtnr1a
NCBI Official Synonym Symbols
MR; MelR
NCBI Protein Information
melatonin receptor type 1A; mel-1A-R; Mel1a receptor
UniProt Protein Name
Melatonin receptor type 1A
UniProt Gene Name
Mtnr1a
UniProt Synonym Gene Names
Mel-1A-R
UniProt Entry Name
MTR1A_MOUSE
Similar Products
Product Notes
The MTNR1A mtnr1a (Catalog #AAA134157) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Melatonin Receptor 1A (MTNR1A) can be used in a range of immunoassay formats including, but not limited to, IP (Immunoprecipitation), ELISA, WB (Western Blot), SDS-PAGE. Researchers should empirically determine the suitability of the MTNR1A mtnr1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: The target protein is fused with two N-terminal Tags, His-tag and S-tag, its sequence is listed below. MHHHHHHSSG LVPRGSGMKE TAAAKFERQH MDSPDLGTDD DDKAMADIGS EF-L LNQNFRKEYK KIIVSLCTAK MFFVESSNEE ADKIKCKPSP LIPNNNLIKV DSV. It is sometimes possible for the material contained within the vial of "Melatonin Receptor 1A (MTNR1A), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
