Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201098_WB13.jpg WB (Western Blot) (WB Suggested Anti-MTNR1A AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)

Rabbit MTNR1A Polyclonal Antibody | anti-MTNR1A antibody

MTNR1A antibody - C-terminal region

Gene Names
MTNR1A; MT1; MEL-1A-R
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Rabbit, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MTNR1A, Antibody; MTNR1A antibody - C-terminal region; anti-MTNR1A antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Rabbit, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GLLNQNFRKEYRRIIVSLCTARVFFVDSSNDVADRVKWKPSPLMTNNNVV
Sequence Length
350
Applicable Applications for anti-MTNR1A antibody
WB (Western Blot)
Homology
Cow: 79%; Dog: 91%; Goat: 79%; Guinea Pig: 82%; Horse: 83%; Human: 100%; Rabbit: 83%; Sheep: 79%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-MTNR1A AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)

product-image-AAA201098_WB13.jpg WB (Western Blot) (WB Suggested Anti-MTNR1A AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)

WB (Western Blot)

(Host: RabbitTarget Name: HIRIP3Sample Type: 293TAntibody Dilution: 1.0ug/ml)

product-image-AAA201098_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: HIRIP3Sample Type: 293TAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-MTNR1A antibody
This is a rabbit polyclonal antibody against MTNR1A. It was validated on Western Blot

Target Description: This gene encodes one of two high affinity forms of a receptor for melatonin, the primary hormone secreted by the pineal gland. This receptor is a G-protein coupled, 7-transmembrane receptor that is responsible for melatonin effects on mammalian circadian rhythm and reproductive alterations affected by day length. The receptor is an integral membrane protein that is readily detectable and localized to two specific regions of the brain. The hypothalamic suprachiasmatic nucleus appears to be involved in circadian rhythm while the hypophysial pars tuberalis may be responsible for the reproductive effects of melatonin.
Product Categories/Family for anti-MTNR1A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
melatonin receptor type 1A
NCBI Official Synonym Full Names
melatonin receptor 1A
NCBI Official Symbol
MTNR1A
NCBI Official Synonym Symbols
MT1; MEL-1A-R
NCBI Protein Information
melatonin receptor type 1A
UniProt Protein Name
Melatonin receptor type 1A
UniProt Gene Name
MTNR1A
UniProt Synonym Gene Names
Mel-1A-R
UniProt Entry Name
MTR1A_HUMAN

Similar Products

Product Notes

The MTNR1A mtnr1a (Catalog #AAA201098) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MTNR1A antibody - C-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Rabbit, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's MTNR1A can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the MTNR1A mtnr1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GLLNQNFRKE YRRIIVSLCT ARVFFVDSSN DVADRVKWKP SPLMTNNNVV. It is sometimes possible for the material contained within the vial of "MTNR1A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.