MUC-16/CA125 recombinant protein
Recombinant Human MUC-16/CA125 Protein
Synonyms
MUC-16/CA125; N/A; Recombinant Human MUC-16/CA125 Protein; Mucin-16, MUC-16, Ovarian cancer-related tumor marker CA125, CA-125, Ovarian carcinoma antigen CA125, MUC16, CA125; MUC-16/CA125 recombinant protein
Host
HEK293 cells
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH7.4.
Sequence
GFTHWIPVPTSSTPGTSTVDLGSGTPSSLPSPTTAGPLLVPFTLNFTITNLKYEEDMHCPGSRKFNTTERVLQSLLGPMFKNTSVGPLYSGCRLTLLRSEKDGAATGVDAICTHRLDPKSPGVDREQLYWELSQLTNGIKELGPYTLDRNSLYVNGFTHQTSAPNTSTPGTSTVDLGTSGTPSSLPSPTSAGPLLVPFTLNFTITNLQYEEDMHHPGSRKFNTTERVLQGLLGPMFKNTSVGLLYSGCRLTLLRPEKNGAATGM
Species
Human
Tag
C-hFc
Endotoxin
<0.01EU/ug of the protein by LAL method.
Bio-Activity
Measured by its binding ability in a functional ELISA. Immobilized human Mesothelin/MSLN at 2ug/mL (100 uL/well) can bind human MUC16 with a linear range of 0.05-4.12ng/mL.
Preparation and Storage
Store at -20 degree C. Store the lyophilized protein at -20 degree C to -80 degree C up to 1 year from the date of receipt.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
Related Product Information for MUC-16/CA125 recombinant protein
The CA125, also known as the MUC16, is a mucin protein that may be found in type I transmembrane or secreted forms that are used monitor the progress of epithelial ovarian cancer therapy. The CA 125 molecule is almost certainly a glycoprotein with a predominance of O-linkages. It is heterogeneous with regard to both size and charge, most likely due to continuous deglycosylation of side chains during its life-span in bodily fluids. It exists as a very large complex (perhaps as much as 4 million daltons) under natural conditions.
Product Categories/Family for MUC-16/CA125 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Protein Name
Mucin-16
UniProt Gene Name
MUC16
UniProt Synonym Gene Names
CA125; MUC-16; CA-125
UniProt Entry Name
MUC16_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The MUC-16/CA125 muc16 (Catalog #AAA283373) is a Recombinant Protein produced from HEK293 cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: GFTHWIPVPT SSTPGTSTVD LGSGTPSSLP SPTTAGPLLV PFTLNFTITN LKYEEDMHCP GSRKFNTTER VLQSLLGPMF KNTSVGPLYS GCRLTLLRSE KDGAATGVDA ICTHRLDPKS PGVDREQLYW ELSQLTNGIK ELGPYTLDRN SLYVNGFTHQ TSAPNTSTPG TSTVDLGTSG TPSSLPSPTS AGPLLVPFTL NFTITNLQYE EDMHHPGSRK FNTTERVLQG LLGPMFKNTS VGLLYSGCRL TLLRPEKNGA ATGM. It is sometimes possible for the material contained within the vial of "MUC-16/CA125, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
