Murinoglobulin-1 Recombinant Protein | MUG1 recombinant protein
Recombinant mouse Murinoglobulin-1
Reactivity
Mouse
Purity
Greater than 90% as determined by SDS-PAGE.
Synonyms
Murinoglobulin-1; N/A; Recombinant mouse Murinoglobulin-1; MUG1 recombinant protein
Host
E Coli
Reactivity
Mouse
Purity/Purification
Greater than 90% as determined by SDS-PAGE.
Form/Format
20mM Tris-HCl based buffer, pH8.0
Sequence Positions
Partial, 700-910aa
Sequence
TPEISWSLRTTLSKRPEEPPRKDPSSNDPLTETIRKYFPETWVWDIVTVNSTGLAEVEMTVPDTITEWKAGALC
LSNDTGLGLSSVVPLQAFKPFFVEVSLPYSVVRGEAFMLKATVMNYLPTSMQMSVQLEASPDFTAVPVGDDQ
DSYCLSANGRHTSSWLVTPKSLGNVNFSVSAEAQQSSEPCGSEVATVPETGRKDTVVKVLIVEPE
Brief Description
Recombinant Protein
Tag Info
His-tag
Preparation and Storage
Store at -20°C, for extended storage, conserve at -20°C or -80°C. Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Related Product Information for MUG1 recombinant protein
A proteinase activates the inhibitor by specific proteolysis in the bait region, which, by an unknown mechanism leads to reaction at the cysteinyl-glutamyl internal thiol ester site and to a conformational change, whereby the proteinase is trapped and/or covalently bound to the inhibitor. While in the tetrameric proteinase inhibitors steric inhibition is sufficiently strong, monomeric forms need a covalent linkage between the activated glutamyl residue of the original thiol ester and a terminal amino group of a lysine or another nucleophilic group on the proteinase, for inhibition to be effective.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
27.13kD
NCBI Official Full Name
murinoglobulin-1
NCBI Official Synonym Full Names
murinoglobulin 1
NCBI Official Symbol
Mug1
NCBI Protein Information
murinoglobulin-1
UniProt Protein Name
Murinoglobulin-1
UniProt Gene Name
Mug1
UniProt Synonym Gene Names
Mug-1; MuG1
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The MUG1 mug1 (Catalog #AAA309751) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is Partial, 700-910aa. The Recombinant mouse Murinoglobulin-1 reacts with Mouse and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: TPEISWSLRT TLSKRPEEPP RKDPSSNDPL TETIRKYFPE TWVWDIVTVN STGLAEVEMT VPDTITEWKA GALC LSNDT GLGLSSVVPL QAFKPFFVEV SLPYSVVRGE AFMLKATVMN YLPTSMQMSV QLEASPDFTA VPVGDDQ DS YCLSANGRHT SSWLVTPKSL GNVNFSVSAE AQQSSEPCGS EVATVPETGR KDTVVKVLIV EPE. It is sometimes possible for the material contained within the vial of "Murinoglobulin-1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.