Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA115579_SDS_PAGE15.jpg SDS-PAGE

Major urinary proteins 11 and 8 Recombinant Protein | Mup8 recombinant protein

Recombinant Mouse Major urinary proteins 11 and 8

Gene Names
Mup11; Gm12549; OTTMUSG00000007431
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Major urinary proteins 11 and 8; N/A; Recombinant Mouse Major urinary proteins 11 and 8; MUP11 and MUP8; Mup8 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-151aa; Full Length
Sequence
REKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE
Sequence Length
181
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA115579_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for Mup8 recombinant protein
Binds pheromones that are released from drying urine of males. These pheromones affect the sexual behavior of fales.
References
Analysis of mouse major urinary protein genes variation between the exonic sequences of group 1 genes and a comparison with an active gene out with group 1 both suggest that gene conversion has occurred between MUP genes.Clark A.J., Chave-Cox A., Ma X., Bishop J.O.EMBO J. 4:3167-3171(1985)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19.6 kDa
NCBI Official Full Name
major urinary protein 11
NCBI Official Synonym Full Names
major urinary protein 11
NCBI Official Symbol
Mup11
NCBI Official Synonym Symbols
Gm12549; OTTMUSG00000007431
NCBI Protein Information
major urinary protein 11
UniProt Protein Name
Major urinary protein 11
UniProt Gene Name
Mup11
UniProt Entry Name
MUP11_MOUSE

Similar Products

Product Notes

The Mup8 mup11 (Catalog #AAA115579) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-151aa; Full Length. The amino acid sequence is listed below: REKINGEWHT IILASDKREK IEDNGNFRLF LEQIHVLENS LVLKFHTVRD EECSELSMVA DKTEKAGEYS VTYDGFNTFT IPKTDYDNFL MAHLINEKDG ETFQLMGLYG REPDLSSDIK ERFAQLCEEH GILRENIIDL SNANRCLQAR E. It is sometimes possible for the material contained within the vial of "Major urinary proteins 11 and 8, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.