Myosin regulatory light chain 2, ventricular/cardiac muscle isoform (MYL2) Recombinant Protein | MYL2 recombinant protein
Recombinant Human Myosin regulatory light chain 2, ventricular/cardiac muscle isoform (MYL2), partial
Gene Names
MYL2; MLC2; CMH10; MLC-2s/v
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Myosin regulatory light chain 2, ventricular/cardiac muscle isoform (MYL2); N/A; Recombinant Human Myosin regulatory light chain 2, ventricular/cardiac muscle isoform (MYL2), partial; MYL2 recombinant protein
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
8-164. Partial.
Sequence
KRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGK
GVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEE
Sequence Length
164
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Product Categories/Family for MYL2 recombinant protein
References
Isolation and nucleotide sequence of the cDNA encoding human ventricular myosin light chain 2.Libera L.D., Hoffmann E., Floroff M., Jackowski G.Nucleic Acids Res. 17:2360-2360(1989) Wu Q.L. Margossian S.S., Umeda P.K., Sciaky D., Anderson P.A.W.Interaction of a conserved peptide domain in recombinant human ventricular myosin light chain-2 with myosin heavy chain.Wadgaonkar R., Shafiq S., Rajmanickam C., Siddiqui M.A.Cell. Mol. Biol. Res. 39:13-26(1993) The major protein expression profile and two-dimensional protein database of human heart.Kovalyov L.I., Shishkin S.S., Efimochkin A.S., Kovalyova M.A., Ershova E.S., Egorov T.A., Musalyamov A.K.Electrophoresis 16:1160-1169(1995) Protein interactions with myocilin.Wentz-Hunter K., Ueda J., Yue B.Y.Invest. Ophthalmol. Vis. Sci. 43:176-182(2002) Mutations in either the essential or regulatory light chains of myosin are associated with a rare myopathy in human heart and skeletal muscle.Poetter K., Jiang H., Hassanzadeh S., Master S.R., Chang A., Dalakas M.C., Rayment I., Sellers J.R., Fananapazir L., Epstein N.D.Nat. Genet. 13:63-69(1996) Identification of two novel mutations in the ventricular regulatory myosin light chain gene (MYL2) associated with familial and classical forms of hypertrophic cardiomyopathy.Flavigny J., Richard P., Isnard R., Carrier L., Charron P., Bonne G., Forissier J.F., Desnos M., Dubourg O., Komajda M., Schwartz K., Hainque B.J. Mol. Med. 76:208-214(1998) Systematic analysis of the regulatory and essential myosin light chain genes genetic variants and mutations in hypertrophic cardiomyopathy.Kabaeva Z.T., Perrot A., Wolter B., Dietz R., Cardim N., Correia J.M., Schulte H.D., Aldashev A.A., Mirrakhimov M.M., Osterziel K.J.Eur. J. Hum. Genet. 10:741-748(2002) Hypertrophic cardiomyopathy distribution of disease genes, spectrum of mutations, and implications for a molecular diagnosis strategy.Richard P., Charron P., Carrier L., Ledeuil C., Cheav T., Pichereau C., Benaiche A., Isnard R., Dubourg O., Burban M., Gueffet J.-P., Millaire A., Desnos M., Schwartz K., Hainque B., Komajda M.Circulation 107:2227-2232(2003) ErratumRichard P., Charron P., Carrier L., Ledeuil C., Cheav T., Pichereau C., Benaiche A., Isnard R., Dubourg O., Burban M., Gueffet J.-P., Millaire A., Desnos M., Schwartz K., Hainque B., Komajda M.Circulation 109:3258-3258(2004) Identification of the genotypes causing hypertrophic cardiomyopathy in northern Sweden.Moerner S., Richard P., Kazzam E., Hellman U., Hainque B., Schwartz K., Waldenstroem A.J. Mol. Cell. Cardiol. 35:841-849(2003)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
21.8 kDa
NCBI Official Full Name
myosin regulatory light chain 2, ventricular/cardiac muscle isoform
NCBI Official Synonym Full Names
myosin light chain 2
NCBI Official Symbol
MYL2
NCBI Official Synonym Symbols
MLC2; CMH10; MLC-2s/v
NCBI Protein Information
myosin regulatory light chain 2, ventricular/cardiac muscle isoform
UniProt Protein Name
Myosin regulatory light chain 2, ventricular/cardiac muscle isoform
UniProt Gene Name
MYL2
UniProt Synonym Gene Names
MLC-2s/v
UniProt Entry Name
MLRV_HUMAN
Similar Products
Product Notes
The MYL2 myl2 (Catalog #AAA81661) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 8-164. Partial. The amino acid sequence is listed below: KRAGGANSNV FSMFEQTQIQ EFKEAFTIMD QNRDGFIDKN DLRDTFAALG RVNVKNEEID EMIKEAPGPI NFTVFLTMFG EKLKGADPEE TILNAFKVFD PEGK GVLKA DYVREMLTTQ AERFSKEEVD QMFAAFPPDV TGNLDYKNLV HIITHGEE. It is sometimes possible for the material contained within the vial of "Myosin regulatory light chain 2, ventricular/cardiac muscle isoform (MYL2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
