Nicotinate phosphoribosyltransferase Recombinant Protein | NAPRT1 recombinant protein

Recombinant Human Nicotinate phosphoribosyltransferase (NAPRT1), partial

Cat. Num. AAA18538

• Gene Names: NAPRT; NAPRT1; PP3856
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Nicotinate phosphoribosyltransferase; N/A; Recombinant Human Nicotinate phosphoribosyltransferase (NAPRT1), partial; FHA-HIT-interacting protein; Nicotinate phosphoribosyltransferase domain-containing protein 1; NAPRT1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 229-538aa; Partial
• Sequence: MLAPAAGEGPGVDLAAKAQVWLEQVCAHLGLGVQEPHPGERAAFVAYALAFPRAFQGLLDTYSVWRSGLPNFLAVALALGELGYRAVGVRLDSGDLLQQAQEIRKVFRAAAAQFQVPWLESVLIVVSNNIDEEALARLAQEGSEVNVIGIGTSVVTCPQQPSLGGVYKLVAVGGQPRMKLTEDPEKQTLPGSKAAFRLLGSDGSPLMDMLQLAEEPVPQAGQELRVWPPGAQEPCTVRPAQVEPLLRLCLQQGQLCEPLPSLAESRALAQLSLSRLSPEHRRLRSPAQYQVVLSERLQALVNSLCAGQSP

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for NAPRT1 recombinant protein

Catalyzes the conversion of nicotinic acid (NA) to NA mononucleotide (NaMN). Essential for NA to increase cellular NAD levels and prevent oxidative stress of the cells.

Product Categories/Family for NAPRT1 recombinant protein

Metabolism

References

Elevation of cellular NAD levels by nicotinic acid and involvement of nicotinic acid phosphoribosyltransferase in human cells.Hara N., Yamada K., Shibata T., Osago H., Hashimoto T., Tsuchiya M.J. Biol. Chem. 282:24574-24582(2007) Identification of nicotinate phosphoribosyltransferase as a novel FHA-HIT interaction protein (FHIP) .Huang C.-H., Chen H., Chen Y. Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.Cell 127:635-648(2006) A probability-based approach for high-throughput protein phosphorylation analysis and site localization.Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P.Nat. Biotechnol. 24:1285-1292(2006) A quantitative atlas of mitotic phosphorylation.Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.Sci. Signal. 3:RA3-RA3(2010) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.Sci. Signal. 4:RS3-RS3(2011) Characterization of human nicotinate phosphoribosyltransferase Kinetic studies, structure prediction and functional analysis by site-directed mutagenesis.Galassi L., Di Stefano M., Brunetti L., Orsomando G., Amici A., Ruggieri S., Magni G.Biochimie 94:300-309(2012) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)

NCBI and Uniprot Product Information

• NCBI GI #: 558472750
• NCBI GeneID: 93100
• NCBI Accession #: NP_001273758.1
• NCBI GenBank Nucleotide #: NM_001286829.1
• UniProt Accession #: Q6XQN6; Q6PJL1; Q6XQN4; Q6XQN5; Q8N5E8; Q9BRG0; A7BFI3
• Molecular Weight: 35.2 kDa
• NCBI Official Full Name: nicotinate phosphoribosyltransferase isoform 2
• NCBI Official Synonym Full Names: nicotinate phosphoribosyltransferase
• NCBI Official Symbol: NAPRT
• NCBI Official Synonym Symbols: NAPRT1; PP3856
• NCBI Protein Information: nicotinate phosphoribosyltransferase
• UniProt Protein Name: Nicotinate phosphoribosyltransferase
• UniProt Gene Name: NAPRT
• UniProt Synonym Gene Names: FHIP; NAPRT1; NAPRTase
• UniProt Entry Name: PNCB_HUMAN