Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA18538_SDS_PAGE.jpg SDS-PAGE

Nicotinate phosphoribosyltransferase Recombinant Protein | NAPRT1 recombinant protein

Recombinant Human Nicotinate phosphoribosyltransferase (NAPRT1), partial

Gene Names
NAPRT; NAPRT1; PP3856
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Nicotinate phosphoribosyltransferase; N/A; Recombinant Human Nicotinate phosphoribosyltransferase (NAPRT1), partial; FHA-HIT-interacting protein; Nicotinate phosphoribosyltransferase domain-containing protein 1; NAPRT1 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
229-538aa; Partial
Sequence
MLAPAAGEGPGVDLAAKAQVWLEQVCAHLGLGVQEPHPGERAAFVAYALAFPRAFQGLLDTYSVWRSGLPNFLAVALALGELGYRAVGVRLDSGDLLQQAQEIRKVFRAAAAQFQVPWLESVLIVVSNNIDEEALARLAQEGSEVNVIGIGTSVVTCPQQPSLGGVYKLVAVGGQPRMKLTEDPEKQTLPGSKAAFRLLGSDGSPLMDMLQLAEEPVPQAGQELRVWPPGAQEPCTVRPAQVEPLLRLCLQQGQLCEPLPSLAESRALAQLSLSRLSPEHRRLRSPAQYQVVLSERLQALVNSLCAGQSP
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA18538_SDS_PAGE.jpg SDS-PAGE
Related Product Information for NAPRT1 recombinant protein
Catalyzes the conversion of nicotinic acid (NA) to NA mononucleotide (NaMN). Essential for NA to increase cellular NAD levels and prevent oxidative stress of the cells.
Product Categories/Family for NAPRT1 recombinant protein
References
Elevation of cellular NAD levels by nicotinic acid and involvement of nicotinic acid phosphoribosyltransferase in human cells.Hara N., Yamada K., Shibata T., Osago H., Hashimoto T., Tsuchiya M.J. Biol. Chem. 282:24574-24582(2007) Identification of nicotinate phosphoribosyltransferase as a novel FHA-HIT interaction protein (FHIP) .Huang C.-H., Chen H., Chen Y. Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.Cell 127:635-648(2006) A probability-based approach for high-throughput protein phosphorylation analysis and site localization.Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P.Nat. Biotechnol. 24:1285-1292(2006) A quantitative atlas of mitotic phosphorylation.Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.Sci. Signal. 3:RA3-RA3(2010) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.Sci. Signal. 4:RS3-RS3(2011) Characterization of human nicotinate phosphoribosyltransferase Kinetic studies, structure prediction and functional analysis by site-directed mutagenesis.Galassi L., Di Stefano M., Brunetti L., Orsomando G., Amici A., Ruggieri S., Magni G.Biochimie 94:300-309(2012) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35.2 kDa
NCBI Official Full Name
nicotinate phosphoribosyltransferase isoform 2
NCBI Official Synonym Full Names
nicotinate phosphoribosyltransferase
NCBI Official Symbol
NAPRT
NCBI Official Synonym Symbols
NAPRT1; PP3856
NCBI Protein Information
nicotinate phosphoribosyltransferase
UniProt Protein Name
Nicotinate phosphoribosyltransferase
UniProt Gene Name
NAPRT
UniProt Synonym Gene Names
FHIP; NAPRT1; NAPRTase
UniProt Entry Name
PNCB_HUMAN

Similar Products

Product Notes

The NAPRT1 naprt (Catalog #AAA18538) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 229-538aa; Partial. The amino acid sequence is listed below: MLAPAAGEGP GVDLAAKAQV WLEQVCAHLG LGVQEPHPGE RAAFVAYALA FPRAFQGLLD TYSVWRSGLP NFLAVALALG ELGYRAVGVR LDSGDLLQQA QEIRKVFRAA AAQFQVPWLE SVLIVVSNNI DEEALARLAQ EGSEVNVIGI GTSVVTCPQQ PSLGGVYKLV AVGGQPRMKL TEDPEKQTLP GSKAAFRLLG SDGSPLMDML QLAEEPVPQA GQELRVWPPG AQEPCTVRPA QVEPLLRLCL QQGQLCEPLP SLAESRALAQ LSLSRLSPEH RRLRSPAQYQ VVLSERLQAL VNSLCAGQSP . It is sometimes possible for the material contained within the vial of "Nicotinate phosphoribosyltransferase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.