Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA283356_AD13.jpg Application Data (Recombinant Human NGF stimulates cell proliferation of the TF?1 human erythroleukemic cells. The ED<sub>50</sub> for this effect is 2.2-8.6 ng/mL, corresponding to a specific activity of 1.16×10<sup>5</sup>-4.55×10<sup>5</sup> units/mg.)

Beta-nerve growth factor/NGFB Recombinant Protein | NGF recombinant protein

Recombinant Human Beta-nerve growth factor/NGFB Protein

Average rating 0.0
No ratings yet
Purity
>92% by SDS-PAGE.
Synonyms
Beta-nerve growth factor/NGFB; N/A; Recombinant Human Beta-nerve growth factor/NGFB Protein; NGFB; HSAN5; Beta-NGF; NGF recombinant protein
Ordering
Host
HEK293 cells
Purity/Purification
>92% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH7.4.
Sequence
EPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
Species
Human
Tag
C-His
Endotoxin
<0.01EU/ug
Bio-Activity
Recombinant Human NGF stimulates cell proliferation of the TF?1 human erythroleukemic cells. The ED50 for this effect is 2.2-8.6ng/mL, corresponding to a specific activity of 1.16×105-4.55×105 units/mg.
Preparation and Storage
Store at -20 degree C. Store the lyophilized protein at -20 degree C to -80 degree C up to 1 year from the date of receipt.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

Application Data

(Recombinant Human NGF stimulates cell proliferation of the TF?1 human erythroleukemic cells. The ED<sub>50</sub> for this effect is 2.2-8.6 ng/mL, corresponding to a specific activity of 1.16×10<sup>5</sup>-4.55×10<sup>5</sup> units/mg.)

product-image-AAA283356_AD13.jpg Application Data (Recombinant Human NGF stimulates cell proliferation of the TF?1 human erythroleukemic cells. The ED<sub>50</sub> for this effect is 2.2-8.6 ng/mL, corresponding to a specific activity of 1.16×10<sup>5</sup>-4.55×10<sup>5</sup> units/mg.)

SDS-PAGE

(Recombinant Human Beta-NGF/NGF/NGFB Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 15-20 kDa.)

product-image-AAA283356_SDS_PAGE15.jpg SDS-PAGE (Recombinant Human Beta-NGF/NGF/NGFB Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 15-20 kDa.)
Related Product Information for NGF recombinant protein
NGF is a well-characterized neurotropic protein that plays a critical role in the development of sympathetic and some sensory neurons in the peripheral nervous system. In addition, NGF can also act in the central nervous system as a trophic factor for basal forebrain cholinergic neurons. NGF has also been shown to have biological effects on non-neuronal tissues. NGF is mitogenic for a factor dependent human erythroleukemic cell line, TF-1. NGF has been found to increase the number of mast cells in neonatal rats and to induce histamine release from peritoneal mast cells. NGF will enhance histamine release and strongly modulate the formation of lipid mediators by basophils in response to various stimuli. NGF will also induce the growth and differentiation of human B lymphocytes as well as suppress apoptosis of murine peritoneal neutrophils. These results, taken together, suggest that NGF is a pleiotropic cytokine which, in addition to its neurotropic activities, may have an important role in the regulation of the immune system.
Product Categories/Family for NGF recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
UniProt Protein Name
Beta-nerve growth factor
UniProt Gene Name
NGF
UniProt Synonym Gene Names
NGFB; Beta-NGF
UniProt Entry Name
NGF_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The NGF ngf (Catalog #AAA283356) is a Recombinant Protein produced from HEK293 cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: EPHSESNVPA GHTIPQAHWT KLQHSLDTAL RRARSAPAAA IAARVAGQTR NITVDPRLFK KRRLRSPRVL FSTQPPREAA DTQDLDFEVG GAAPFNRTHR SKRSSSHPIF HRGEFSVCDS VSVWVGDKTT ATDIKGKEVM VLGEVNINNS VFKQYFFETK CRDPNPVDSG CRGIDSKHWN SYCTTTHTFV KALTMDGKQA AWRFIRIDTA CVCVLSRKAV RRA. It is sometimes possible for the material contained within the vial of "Beta-nerve growth factor/NGFB, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.