Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

B-type Natriuretic Recombinant Protein | BNP recombinant protein

Recombinant Human B-type Natriuretic Protein

Gene Names
NPPB; BNP
Purity
Greater than 95.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Synonyms
B-type Natriuretic; N/A; Recombinant Human B-type Natriuretic Protein; BNP Human; B-type Natriuretic Peptide Human Recombinant; NPPB; Natriuretic Peptide Precursor B; BNP; B-type Natriuretic Peptide; BNP recombinant protein
Ordering
Host
E Coli
Purity/Purification
Greater than 95.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Form/Format
Natriuretic Peptide Precursor B was lyophilized from 0.4ml PBS buffer containing 20mM phosphate buffer and 0.6mM sodium chloride.
Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Sequence Length
134
Solubility
It is recommended to reconstitute the lyophilized B-type Natriuretic Peptide in sterile 18M Omega -cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
Preparation and Storage
Lyophilized B-type Natriuretic Peptide although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution NPPB should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Related Product Information for BNP recombinant protein
Description: B-type Natriuretic Peptide Human Recombinant produced in E Coli is a single, non-glycosylated, polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton. NPPB is purified by proprietary chromatographic techniques.

Introduction: Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. Helps restore the body's salt and water balance. Improves heart function.
Product Categories/Family for BNP recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14,726 Da
NCBI Official Full Name
natriuretic peptides B preproprotein
NCBI Official Synonym Full Names
natriuretic peptide B
NCBI Official Symbol
NPPB
NCBI Official Synonym Symbols
BNP
NCBI Protein Information
natriuretic peptides B; brain type natriuretic peptide; gamma-brain natriuretic peptide; natriuretic peptide precursor B; natriuretic protein
UniProt Protein Name
Natriuretic peptides B
UniProt Gene Name
NPPB
UniProt Synonym Gene Names
BNP(1-32); BNP-32
UniProt Entry Name
ANFB_HUMAN

Similar Products

Product Notes

The BNP nppb (Catalog #AAA38159) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: SPKMVQGSGC FGRKMDRISS SSGLGCKVLR RH. It is sometimes possible for the material contained within the vial of "B-type Natriuretic, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.