Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA283358_AD13.jpg Application Data (Recombinant Human Pro-neuregulin-1/NRG1 (Beta1) stimulates serum-free cell proliferation assay using MCF-7 human breast cancer cells. The ED<sub>50</sub> for this effect is typically 0.62-2.48 ng/mL, corresponding to a specific activity of 4.03×10<sup>5</sup>~1.61×10<sup>6</sup> units/mg.)

Pro-neuregulin-1/NRG1 (Beta1) Recombinant Protein | NRG1 recombinant protein

Recombinant Human Pro-neuregulin-1/NRG1 (Beta1) Protein

Average rating 0.0
No ratings yet
Purity
>92% by SDS-PAGE.
Synonyms
Pro-neuregulin-1/NRG1 (Beta1); N/A; Recombinant Human Pro-neuregulin-1/NRG1 (Beta1) Protein; GGF; HGL; HRG; NDF; ARIA; GGF2; HRG1; HRGA; SMDF; MST131; MSTP131; NRG1-IT2;Pro-neuregulin-1;NRG1 (Beta1); NRG1 recombinant protein
Ordering
Host
E coli
Purity/Purification
>92% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH7.4.
Sequence
TSHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCQPGFTGARCTENVPMKVQNQEKAEELYQKRVLTI
Species
Human
Endotoxin
<1EU/ug
Bio-Activity
Measured in a serum-free cell proliferation assay using MCF-7 human breast cancer cells. The ED50 for this effect is typically 0.62-2.48ng/mL, corresponding to a specific activity of 4.03×105~1.61×106 units/mg.
Preparation and Storage
Store at -20 degree C. Store the lyophilized protein at -20 degree C to -80 degree C up to 1 year from the date of receipt.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

Application Data

(Recombinant Human Pro-neuregulin-1/NRG1 (Beta1) stimulates serum-free cell proliferation assay using MCF-7 human breast cancer cells. The ED<sub>50</sub> for this effect is typically 0.62-2.48 ng/mL, corresponding to a specific activity of 4.03×10<sup>5</sup>~1.61×10<sup>6</sup> units/mg.)

product-image-AAA283358_AD13.jpg Application Data (Recombinant Human Pro-neuregulin-1/NRG1 (Beta1) stimulates serum-free cell proliferation assay using MCF-7 human breast cancer cells. The ED<sub>50</sub> for this effect is typically 0.62-2.48 ng/mL, corresponding to a specific activity of 4.03×10<sup>5</sup>~1.61×10<sup>6</sup> units/mg.)

SDS-PAGE

(Recombinant Human Pro-neuregulin-1/NRG1?Beta1? Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 10-15 kDa.)

product-image-AAA283358_SDS_PAGE15.jpg SDS-PAGE (Recombinant Human Pro-neuregulin-1/NRG1?Beta1? Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 10-15 kDa.)
Related Product Information for NRG1 recombinant protein
neuregulin-1 (heregulin-1, NRG1) is a member of neuregulin family, which is comprised of four genes thatencode a large number of secreted or membrane-bound isoforms. All family members share an EGF-likedomain that interacts with the ErbB family of tyrosine kinase receptors. NRG1 isoforms can be classified intotype I, type II and type III isoforms. NRG1 directs ligand for ERBB3 and ERBB4 tyrosine kinase receptors, concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylationand activation of the ERBB receptors. NRG proteins show distinct spatial and temporal expression patterns andplay important roles during development of both the nervous system and the heart.
Product Categories/Family for NRG1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Protein Name
Pro-neuregulin-1, membrane-bound isoform
UniProt Gene Name
NRG1
UniProt Synonym Gene Names
GGF; HGL; HRGA; NDF; SMDF; Pro-NRG1; ARIA; HRG
UniProt Entry Name
NRG1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The NRG1 nrg1 (Catalog #AAA283358) is a Recombinant Protein produced from E coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: TSHLVKCAEK EKTFCVNGGE CFMVKDLSNP SRYLCKCQPG FTGARCTENV PMKVQNQEKA EELYQKRVLT I. It is sometimes possible for the material contained within the vial of "Pro-neuregulin-1/NRG1 (Beta1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.