Rotavirus A Non-Structural Glycoprotein 4 Recombinant Protein | NSP4 recombinant protein
Recombinant Rotavirus A Non-Structural Glycoprotein 4, Partial
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Rotavirus A Non-Structural Glycoprotein 4; N/A; Recombinant Rotavirus A Non-Structural Glycoprotein 4, Partial; NSP4 recombinant protein
Host
Yeast
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
52-175aa; Partial
Sequence
PTMKIALKASKCSYKVIKYCVVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQIELLKRIHDNLITRPVNVIDMSMEFNQKNIKTLDEWESRKNPYEPSEVTASM
Species
Rotavirus A (strain Human/United Kingdom/ST3/1975 G4-P2A[6]-I1-R1-C1-M1-A1-N1-T1-E1-H1) (RV-A) (Rotavirus A (strain St. Thomas 3))
Tag
N-terminal 6xHis-tagged
Subcellular Location
Non-structural glycoprotein 4: Host rough endoplasmic reticulum membrane, Single-pass type III membrane protein, Host membrane, host caveola, Single-pass type III membrane protein, Secreted
Protein Families
Rotavirus NSP4 family
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for NSP4 recombinant protein
Involved in virus morphogenesis. Functions as a receptor for the immature double-layered inner capsid particle (ICP) which transiently buds into the lumen of the rough endoplasmic reticulum during viral maturation (By similarity).
References
Group A human rotavirus genomics evidence that gene constellations are influenced by viral protein interactions.Heiman E.M., McDonald S.M., Barro M., Taraporewala Z.F., Bar-Magen T., Patton J.T.J. Virol. 82:11106-11116(2008).
NCBI and Uniprot Product Information
Similar Products
Product Notes
The Rotavirus A Non-Structural Glycoprotein 4 nsp4 (Catalog #AAA235626) is a Recombinant Protein produced from Yeast and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 52-175aa; Partial. The amino acid sequence is listed below: PTMKIALKAS KCSYKVIKYC VVTIINTLLK LAGYKEQVTT KDEIEQQMDR IVKEMRRQLE MIDKLTTREI EQIELLKRIH DNLITRPVNV IDMSMEFNQK NIKTLDEWES RKNPYEPSEV TASM. It is sometimes possible for the material contained within the vial of "Rotavirus A Non-Structural Glycoprotein 4, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.