Non-structural polyprotein, partial Recombinant Protein | CHIKVgp1 recombinant protein
Recombinant Chikungunya virus Non-structural polyprotein, partial
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Non-structural polyprotein, partial; N/A; Recombinant Chikungunya virus Non-structural polyprotein, partial; Non-structural polyprotein; Polyprotein nsP1234; P1234Cleaved into the following 5 chains:; 1. P123; 2. mRNA-capping enzyme nsP1; EC=3. 2.1.1.-; EC=4. 2.7.7.-; Non-structural protein 1; Protease nsP2; EC=3.1.3.33; EC=3.4.22.-; EC=3.6.1.15; EC=3.6.4.13; No; CHIKVgp1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2228-2474aa; Partial
Sequence
DTVLETDIASFDKSQDDSLALTALMLLEDLGVDHSLLDLIEAAFGEISSCHLPTGTRFKFGAMMKSGMFLTLFVNTLLNITIASRVLEDRLTKSACAAFIGDDNIIHGVVSDELMAARCATWMNMEVKIIDAVVSQKAPYFCGGFILHDIVTGTACRVADPLKRLFKLGKPLAAGDEQDEDRRRALADEVVRWQRTGLIDELEKAVYSRYEVQGISVVVMSMATFASSRSNFEKLRGPVVTLYGGPK
Sequence Length
2474
Species
Chikungunya virus (strain S27-African prototype) (CHIKV)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31.1 kDa
NCBI Official Full Name
nonstructural polyprotein
NCBI Official Symbol
CHIKVgp1
NCBI Protein Information
contains nsp1, nsp2, nsp3, and nsp4 proteins; nonstructural polyprotein
UniProt Protein Name
Non-structural polyprotein
UniProt Gene Name
P1234
UniProt Synonym Gene Names
nsP2; nsP3; nsP4
UniProt Entry Name
POLN_CHIKS
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The CHIKVgp1 p1234 (Catalog #AAA117236) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2228-2474aa; Partial. The amino acid sequence is listed below: DTVLETDIAS FDKSQDDSLA LTALMLLEDL GVDHSLLDLI EAAFGEISSC HLPTGTRFKF GAMMKSGMFL TLFVNTLLNI TIASRVLEDR LTKSACAAFI GDDNIIHGVV SDELMAARCA TWMNMEVKII DAVVSQKAPY FCGGFILHDI VTGTACRVAD PLKRLFKLGK PLAAGDEQDE DRRRALADEV VRWQRTGLID ELEKAVYSRY EVQGISVVVM SMATFASSRS NFEKLRGPVV TLYGGPK. It is sometimes possible for the material contained within the vial of "Non-structural polyprotein, partial, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
