Nuclear pore complex protein Nup98-Nup96 (Nup98) Recombinant Protein | Nup98 recombinant protein
Recombinant Rat Nuclear pore complex protein Nup98-Nup96 (Nup98) , partial
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Nuclear pore complex protein Nup98-Nup96 (Nup98); N/A; Recombinant Rat Nuclear pore complex protein Nup98-Nup96 (Nup98) , partial; Nup98 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
738-979; Partial, include the Peptidase S59 domain
Sequence
KVGYYTIPSMDDLAKITNEKGECIVSDFTIGRKGYGSIYFEGDVNLTNLNLDDIVHIRRKEVIVYVDDNQKPPVGEGLNRKAEVTLDGVWPTDKTSRCLIKSPDRLADINYEGRLEAVSRKQGAQFKEYRPETGSWVFKVSHFSKYGLQDSDEEEEEHPPKTTSKKLKTAPLPPAGQATTFQMTLNGKPAPPPQSQSPEVEQLGRVVELDSDMVDITQEPVPDSVLEESVPEDQEPVSASTQ
Sequence Length
979
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Nup98 recombinant protein
Signal-mediated nuclear import and export proceed through the nuclear pore complex (NPC), which is comprised of approximately 50 unique proteins collectively known as nucleoporins. The 98 kD nucleoporin is generated through a biogenesis pathway that involves synthesis and proteolytic cleavage of a 186 kD precursor protein. This cleavage results in the 98 kD nucleoporin as well as a 96 kD nucleoporin, both of which are localized to the nucleoplasmic side of the NPC. Rat studies show that the 98 kD nucleoporin functions as one of several docking site nucleoporins of transport substrates. The human gene has been shown to fuse to several genes following chromsome translocatons in acute myelogenous leukemia (AML) and T-cell acute lymphocytic leukemia (T-ALL). This gene is one of several genes located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. Alternative splicing of this gene results in several transcript variants; however, not all variants have been fully described.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
97,928 Da
NCBI Official Full Name
nuclear pore complex protein Nup98-Nup96 proprotein
NCBI Official Synonym Full Names
nucleoporin 98
NCBI Official Symbol
Nup98
NCBI Protein Information
nuclear pore complex protein Nup98-Nup96
UniProt Protein Name
Nuclear pore complex protein Nup98-Nup96
UniProt Gene Name
Nup98
UniProt Synonym Gene Names
Nup98; Nup96
Similar Products
Product Notes
The Nup98 nup98 (Catalog #AAA81650) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 738-979; Partial, include the Peptidase S59 domain. The amino acid sequence is listed below: KVGYYTIPSM DDLAKITNEK GECIVSDFTI GRKGYGSIYF EGDVNLTNLN LDDIVHIRRK EVIVYVDDNQ KPPVGEGLNR KAEVTLDGVW PTDKTSRCLI KSPDRLADIN YEGRLEAVSR KQGAQFKEYR PETGSWVFKV SHFSKYGLQD SDEEEEEHPP KTTSKKLKTA PLPPAGQATT FQMTLNGKPA PPPQSQSPEV EQLGRVVELD SDMVDITQEP VPDSVLEESV PEDQEPVSAS TQ. It is sometimes possible for the material contained within the vial of "Nuclear pore complex protein Nup98-Nup96 (Nup98), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.