Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200461_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: OBP2ASample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit OBP2A Polyclonal Antibody | anti-OBP2A antibody

OBP2A Antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
OBP2A; OBP; LCN13; OBP2C; OBPIIa; hOBPIIa
Reactivity
Tested/Predicted Species Reactivity: Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
OBP2A, Antibody; OBP2A Antibody - middle region; OBP, LCN13, OBP2C, OBPIIa, hOBPIIa; anti-OBP2A antibody
Ordering
Host
Rabbit
Reactivity
Tested/Predicted Species Reactivity: Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5mg/mL (varies by lot)
Sequence
Synthetic peptide located within the following region: QKKILMRKTEEPGKFSAYGGRKLIYLQELPGTDDYVFYCKDQRRGGLRYM
Sequence Length
228
Applicable Applications for anti-OBP2A antibody
WB (Western Blot)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human OBP2A
Protein Size (# AA)
228 amino acids
Blocking Peptide
OBP2A peptide ( ) is used for blocking the activity of OBP2A antibody (MBS3212047)
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: OBP2ASample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

product-image-AAA200461_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: OBP2ASample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-OBP2A antibody
Target Description: This gene encodes a small extracellular protein belonging to the lipocalin superfamily. The protein is thought to transport small, hydrophobic, volatile molecules or odorants through the nasal mucus to olfactory receptors, and may also function as a scavenger of highly concentrated or toxic odors. The protein is expressed as a monomer in the nasal mucus, and can bind diverse types of odorants with a higher affinity for aldehydes and fatty acids. This gene and a highly similar family member are located in a cluster of lipocalin genes on chromosome 9. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.
Product Categories/Family for anti-OBP2A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25kDa
NCBI Official Full Name
odorant-binding protein 2a isoform alpha
NCBI Official Synonym Full Names
odorant binding protein 2A
NCBI Official Symbol
OBP2A
NCBI Official Synonym Symbols
OBP; LCN13; OBP2C; OBPIIa; hOBPIIa
NCBI Protein Information
odorant-binding protein 2a
UniProt Protein Name
Odorant-binding protein 2a
UniProt Gene Name
OBP2A
UniProt Synonym Gene Names
OBPIIa
UniProt Entry Name
OBP2A_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The OBP2A obp2a (Catalog #AAA200461) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The OBP2A Antibody - middle region reacts with Tested/Predicted Species Reactivity: Human and may cross-react with other species as described in the data sheet. AAA Biotech's OBP2A can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the OBP2A obp2a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QKKILMRKTE EPGKFSAYGG RKLIYLQELP GTDDYVFYCK DQRRGGLRYM. It is sometimes possible for the material contained within the vial of "OBP2A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.