Outer membrane protein C Recombinant Protein | ompC recombinant protein

Recombinant Escherichia coli (strain K12) Outer membrane protein C

Cat. Num. AAA18709

• Gene Names: ompC; butR; ECK2207; JW2203; meoA; par
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Outer membrane protein C; Recombinant Escherichia coli (strain K12) Outer membrane protein C; Outer membrane protein 1B; Porin OmpC; ompC recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 22-367aa; Full Length of Mature Protein
• Sequence: AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for ompC recombinant protein

Forms pores that allow passive diffusion of small molecules across the outer membrane.

References

A comparative study on the genes for three porins of the Escherichia coli outer membrane. DNA sequence of the osmoregulated ompC gene.Mizuno T., Chou M.-Y., Inouye M.J. Biol. Chem. 258:6932-6940(1983) A 460-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 40.1-50.0 min region on the linkage map.Itoh T., Aiba H., Baba T., Fujita K., Hayashi K., Inada T., Isono K., Kasai H., Kimura S., Kitakawa M., Kitagawa M., Makino K., Miki T., Mizobuchi K., Mori H., Mori T., Motomura K., Nakade S., Nakamura Y., Nashimoto H., Nishio Y., Oshima T., Saito N., Sampei G., Seki Y., Sivasundaram S., Tagami H., Takeda J., Takemoto K., Wada C., Yamamoto Y., Horiuchi T.DNA Res. 3:379-392(1996) The complete genome sequence of Escherichia coli K-12.Blattner F.R., Plunkett G. III, Bloch C.A., Perna N.T., Burland V., Riley M., Collado-Vides J., Glasner J.D., Rode C.K., Mayhew G.F., Gregor J., Davis N.W., Kirkpatrick H.A., Goeden M.A., Rose D.J., Mau B., Shao Y.Science 277:1453-1462(1997) Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006) Automated multiplex sequencing of the E Coli genome.Richterich P., Lakey N., Gryan G., Jaehn L., Mintz L., Robison K., Church G.M. DNA sequence of the promoter region of the ompC gene and the amino acid sequence of the signal peptide of pro-OmpC protein of Escherichia coli.Mizuno T., Chou M.-Y., Inouye M.FEBS Lett. 151:159-164(1983) Construction of a series of ompF-ompC chimeric genes by in vivo homologous recombination in Escherichia coli and characterization of the translational products.Nogami T., Mizuno T., Mizushima S.J. Bacteriol. 164:797-801(1985) Comparing the predicted and observed properties of proteins encoded in the genome of Escherichia coli K-12.Link A.J., Robison K., Church G.M.Electrophoresis 18:1259-1313(1997) Extraction of membrane proteins by differential solubilization for separation using two-dimensional gel electrophoresis.Molloy M.P., Herbert B.R., Walsh B.J., Tyler M.I., Traini M., Sanchez J.-C., Hochstrasser D.F., Williams K.L., Gooley A.A.Electrophoresis 19:837-844(1998) Escherichia coli proteome analysis using the gene-protein database.VanBogelen R.A., Abshire K.Z., Moldover B., Olson E.R., Neidhardt F.C.Electrophoresis 18:1243-1251(1997) Crystal structure of osmoporin OmpC from E. coli at 2.0 A.Basle A., Rummel G., Storici P., Rosenbusch J.P., Schirmer T.J. Mol. Biol. 362:933-942(2006) Crystal structure of the membrane protein Ompc complex with antibacterial lactoferrin.Baalaji S., Acharya R.K., Singh T.P., Krishnaswamy S.Submitted (SEP-2006) to the PDB data bank

NCBI and Uniprot Product Information

• NCBI GI #: 16130152
• NCBI GeneID: 946716
• NCBI Accession #: NP_416719.1
• NCBI GenBank Nucleotide #: NC_000913.3
• UniProt Accession #: P06996
• Molecular Weight: 54.3 kDa
• NCBI Official Full Name: outer membrane porin protein C
• NCBI Official Symbol: ompC
• NCBI Official Synonym Symbols: butR; ECK2207; JW2203; meoA; par
• NCBI Protein Information: outer membrane porin protein C
• UniProt Protein Name: Outer membrane protein C
• UniProt Gene Name: ompC
• UniProt Synonym Gene Names: meoA; par
• UniProt Entry Name: OMPC_ECOLI