Outer membrane protein S1 Recombinant Protein | ompS1 recombinant protein
Recombinant Salmonella typhi Outer membrane protein S1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Outer membrane protein S1; N/A; Recombinant Salmonella typhi Outer membrane protein S1; Salmonella typhi; ompS1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-394aa; Full Length
Sequence
AEIYNKNGNKLDLYGKVDGLRYFSDNAGDDGDQSYARIGFKGETQINDMLTGYGQWEYNIKVNTTEGEGANSWTRLGFAGLKFGEYGSFDYGRNYGVIYDIEAWTDALPEFGGDTYTQTDVYMLGRTNGVATYRNTDFFGLVEGLNFALQYQGNNENGGAGAGEGTGNGGNRKLARENGDGFGMSTSYDFDFGLSLGAAYSSSDRSDNQVARGYGDGMNERNNYAGGETAEAWTIGAKYDAYNVYLAAMYAETRNMTYYGGGNGEGNGSIANKTQNFEVVAQYQFDFGLRPSIAYLQSKGKDLGGQEVHRGNWRYTDKDLVKYVDVGMTYYFNKNMSTYVDYKINLLDEDDDFYANNGIATDDIVGVGLVYQF
Sequence Length
394
Species
Salmonella typhi
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for ompS1 recombinant protein
Forms pores that allow passive diffusion of small molecules across the outer membrane.
References
"Isolation and characterization of ompS1, a novel Salmonella typhi outer membrane protein-encoding gene." Fernandez-Mora M., Oropeza R., Puente J.L., Calva E. Gene 158:67-72(1995)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57.2 kDa
NCBI Official Full Name
outer membrane protein S1
NCBI Official Symbol
ompS1
NCBI Protein Information
outer membrane protein S1
UniProt Protein Name
Outer membrane protein S1
UniProt Gene Name
ompS1
UniProt Synonym Gene Names
ompS
UniProt Entry Name
OMPS1_SALTI
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The ompS1 omps1 (Catalog #AAA117608) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-394aa; Full Length. The amino acid sequence is listed below: AEIYNKNGNK LDLYGKVDGL RYFSDNAGDD GDQSYARIGF KGETQINDML TGYGQWEYNI KVNTTEGEGA NSWTRLGFAG LKFGEYGSFD YGRNYGVIYD IEAWTDALPE FGGDTYTQTD VYMLGRTNGV ATYRNTDFFG LVEGLNFALQ YQGNNENGGA GAGEGTGNGG NRKLARENGD GFGMSTSYDF DFGLSLGAAY SSSDRSDNQV ARGYGDGMNE RNNYAGGETA EAWTIGAKYD AYNVYLAAMY AETRNMTYYG GGNGEGNGSI ANKTQNFEVV AQYQFDFGLR PSIAYLQSKG KDLGGQEVHR GNWRYTDKDL VKYVDVGMTY YFNKNMSTYV DYKINLLDED DDFYANNGIA TDDIVGVGLV YQF. It is sometimes possible for the material contained within the vial of "Outer membrane protein S1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
