Outer membrane porin protein OmpD Recombinant Protein | ompD recombinant protein
Recombinant Salmonella typhimurium Outer membrane porin protein OmpD
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Outer membrane porin protein OmpD; N/A; Recombinant Salmonella typhimurium Outer membrane porin protein OmpD; ompD recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-362aa; Full Length of Mature Protein
Sequence
AEVYNKDGNKLDLYGKVHAQHYFSDDNGSDGDKTYARLGFKGETQINDQLTGFGQWEYEFKGNRTESQGADKDKTRLAFAGLKFADYGSFDYGRNYGVAYDIGAWTDVLPEFGGDTWTQTDVFMTGRTTGVATYRNTDFFGLVEGLNFAAQYQGKNDRDGAYESNGDGFGLSATYEYEGFGVGAAYAKSDRTNNQVKAASNLNAAGKNAEVWAAGLKYDANNIYLATTYSETLNMTTFGEDAAGDAFIANKTQNFEAVAQYQFDFGLRPSIAYLKSKGKNLGTYGDQDLVEYIDVGATYYFNKNMSTFVDYKINLLDDSDFTKAAKVSTDNIVAVGLNYQF
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for ompD recombinant protein
Forms pores that allow passive diffusion of small molecules across the outer membrane.
References
Complete genome sequence of Salmonella enterica serovar Typhimurium LT2.McClelland M., Sanderson K.E., Spieth J., Clifton S.W., Latreille P., Courtney L., Porwollik S., Ali J., Dante M., Du F., Hou S., Layman D., Leonard S., Nguyen C., Scott K., Holmes A., Grewal N., Mulvaney E., Ryan E., Sun H., Florea L., Miller W., Stoneking T., Nhan M., Waterston R., Wilson R.K.Nature 413:852-856(2001)
The methyl viologen-resistance-encoding gene smvA of Salmonella typhimurium.Hongo E., Morimyo M., Mita K., Machida I., Hama-Inaba H., Tsuji H., Ichimura S., Noda Y.Gene 148:173-174(1994)
Singh S.P., Miller S., Williams Y.U., Rudd K.E., Nikaido H.Unpublished observations (FEB-1996)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53.6 kDa
NCBI Official Full Name
outer membrane porin protein OmpD
NCBI Official Symbol
ompD
NCBI Protein Information
outer membrane porin protein OmpD
UniProt Protein Name
Outer membrane porin protein OmpD
UniProt Gene Name
ompD
UniProt Synonym Gene Names
nmpC
UniProt Entry Name
OMPD_SALTY
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The ompD ompd (Catalog #AAA18683) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-362aa; Full Length of Mature Protein. The amino acid sequence is listed below: AEVYNKDGNK LDLYGKVHAQ HYFSDDNGSD GDKTYARLGF KGETQINDQL TGFGQWEYEF KGNRTESQGA DKDKTRLAFA GLKFADYGSF DYGRNYGVAY DIGAWTDVLP EFGGDTWTQT DVFMTGRTTG VATYRNTDFF GLVEGLNFAA QYQGKNDRDG AYESNGDGFG LSATYEYEGF GVGAAYAKSD RTNNQVKAAS NLNAAGKNAE VWAAGLKYDA NNIYLATTYS ETLNMTTFGE DAAGDAFIAN KTQNFEAVAQ YQFDFGLRPS IAYLKSKGKN LGTYGDQDLV EYIDVGATYY FNKNMSTFVD YKINLLDDSD FTKAAKVSTD NIVAVGLNYQ F . It is sometimes possible for the material contained within the vial of "Outer membrane porin protein OmpD, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
