Hepatitis E virus genotype 1 Non-structural polyprotein pORF1 Recombinant Protein | ORF1 recombinant protein
Recombinant Hepatitis E virus genotype 1 Non-structural polyprotein pORF1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Hepatitis E virus genotype 1 Non-structural polyprotein pORF1; N/A; Recombinant Hepatitis E virus genotype 1 Non-structural polyprotein pORF1; ORF1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
60-240aa; Full Length
Sequence
EVFWNHPIQRVIHNELELYCRARSGRCLEIGAHPRSINDNPNVVHRCFLRPAGRDVQRWYTAPTRGPAANCRRSALRGLPAADRTYCFDGFSGCNFPAETGIALYSLHDMSPSDVAEAMFRHGMTRLYAALHLPPEVLLPPGTYRTASYLLIHDGRRVVVTYEGDTSAGYNHDVSNLRSWI
Sequence Length
1693
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for ORF1 recombinant protein
Methyltransferase displays a cytoplasmic capping enzyme activity. This function is necessary since all viral RNAs are synthesized in the cytoplasm, and host capping enzymes are restricted to the nucleus. The enzymatic reaction involves a covalent link between 7-methyl-GMP and the methyltransferase, whereas eukaryotic capping enzymes form a covalent complex only with GMP. Methyltransferase catalyzes transfer of a methyl group from S-adenosylmethionine to GTP and GDP to yield m7GTP or m7GDP. GMP, GpppG, and GpppA were poor substrates for the methyltransferase. This enzyme also displays guanylyltransferase activity to form a covalent complex, methyltransferase-m7GMP, from which 7-methyl-GMP is transferred to the mRNA to create the cap structure. Cap analogs such as m7GTP, m7GDP, et2m7GMP, and m2et7GMP inhibit the methyltransferase reaction. RNA-directed RNA polymerase plays an essential role in the virus replication. Binds to the 3'-end of the genomic RNA, probably to initiate replication.
References
Characterization of a prototype strain of hepatitis E virus.Tsarev S.A., Emerson S.U., Reyes G.R., Tsareva T.S., Legters L.J., Malik I.A., Iqbal M., Purcell R.H.Proc. Natl. Acad. Sci. U.S.A. 89:559-563(1992) Recombinant hepatitis E virus genomes infectious for primates importance of capping and discovery of a cis-reactive element.Emerson S.U., Zhang M., Meng X.J., Nguyen H., St Claire M., Govindarajan S., Huang Y.K., Purcell R.H.Proc. Natl. Acad. Sci. U.S.A. 98:15270-15275(2001)
NCBI and Uniprot Product Information
Similar Products
Product Notes
The ORF1 orf1 (Catalog #AAA114561) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 60-240aa; Full Length. The amino acid sequence is listed below: EVFWNHPIQR VIHNELELYC RARSGRCLEI GAHPRSINDN PNVVHRCFLR PAGRDVQRWY TAPTRGPAAN CRRSALRGLP AADRTYCFDG FSGCNFPAET GIALYSLHDM SPSDVAEAMF RHGMTRLYAA LHLPPEVLLP PGTYRTASYL LIHDGRRVVV TYEGDTSAGY NHDVSNLRSW I. It is sometimes possible for the material contained within the vial of "Hepatitis E virus genotype 1 Non-structural polyprotein pORF1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
