Genome polyprotein Recombinant Protein | HCV4_gp1 recombinant protein
Recombinant Hepatitis C virus genotype 4a Genome polyprotein
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Genome polyprotein; N/A; Recombinant Hepatitis C virus genotype 4a Genome polyprotein; Recombinant Genome polyprotein; Genome polyprotein Cleaved into the following 11 chains: 1. Core protein p21; Capsid protein C p21 Core protein p19 Envelope glycoprotein E1; gp32 gp35 Envelope glycoprotein E2; NS1 gp68 gp70 p7 Protease NS2-3; p23 EC= 3.4.; HCV4_gp1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
190-358aa; Partial
Sequence
SAVNYRNVSGIYHVTNDCPNSSIVYEADHHIMHLPGCVPCVREGNQSRCWVALTPTVAAPYIGAPLESLRSHVDLMVGAATVCSGLYIGDLCGGLFLVGQMFSFRPRRHWTTQDCNCSIYTGHITGHRMAWDMMMNWSPTTTLVLAQVMRIPTTLVDLLSGGHWGVLVG
Species
Hepatitis C virus genotype 4a (isolate ED43) (HCV)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
327,599 Da
NCBI Official Full Name
HCV polyprotein
NCBI Official Symbol
HCV4_gp1
NCBI Protein Information
HCV polyprotein
UniProt Protein Name
Genome polyprotein
UniProt Gene Name
p23
UniProt Synonym Gene Names
NS4A; NS4B; NS5A
UniProt Entry Name
POLG_HCVED
Similar Products
Product Notes
The HCV4_gp1 p23 (Catalog #AAA114863) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 190-358aa; Partial. The amino acid sequence is listed below: SAVNYRNVSG IYHVTNDCPN SSIVYEADHH IMHLPGCVPC VREGNQSRCW VALTPTVAAP YIGAPLESLR SHVDLMVGAA TVCSGLYIGD LCGGLFLVGQ MFSFRPRRHW TTQDCNCSIY TGHITGHRMA WDMMMNWSPT TTLVLAQVMR IPTTLVDLLS GGHWGVLVG. It is sometimes possible for the material contained within the vial of "Genome polyprotein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.