P2Y purinoceptor 12 (P2RY12) Recombinant Protein | P2RY12 recombinant protein
Recombinant Human P2Y purinoceptor 12 (P2RY12)
Gene Names
P2RY12; HORK3; P2Y12; ADPG-R; BDPLT8; SP1999; P2T(AC); P2Y(AC); P2Y(12)R; P2Y(ADP); P2Y(cyc)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
P2Y purinoceptor 12 (P2RY12); N/A; Recombinant Human P2Y purinoceptor 12 (P2RY12); P2RY12 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-342. Full Length
Sequence
MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for P2RY12 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
42.2 kDa
NCBI Official Full Name
P2Y purinoceptor 12
NCBI Official Synonym Full Names
purinergic receptor P2Y12
NCBI Official Symbol
P2RY12
NCBI Official Synonym Symbols
HORK3; P2Y12; ADPG-R; BDPLT8; SP1999; P2T(AC); P2Y(AC); P2Y(12)R; P2Y(ADP); P2Y(cyc)
NCBI Protein Information
P2Y purinoceptor 12
UniProt Protein Name
P2Y purinoceptor 12
UniProt Gene Name
P2RY12
UniProt Synonym Gene Names
HORK3; P2Y12; ADPG-R; P2Y(ADP)
UniProt Entry Name
P2Y12_HUMAN
Similar Products
Product Notes
The P2RY12 p2ry12 (Catalog #AAA230720) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-342. Full Length. The amino acid sequence is listed below: MQAVDNLTSA PGNTSLCTRD YKITQVLFPL LYTVLFFVGL ITNGLAMRIF FQIRSKSNFI IFLKNTVISD LLMILTFPFK ILSDAKLGTG PLRTFVCQVT SVIFYFTMYI SISFLGLITI DRYQKTTRPF KTSNPKNLLG AKILSVVIWA FMFLLSLPNM ILTNRQPRDK NVKKCSFLKS EFGLVWHEIV NYICQVIFWI NFLIVIVCYT LITKELYRSY VRTRGVGKVP RKKVNVKVFI IIAVFFICFV PFHFARIPYT LSQTRDVFDC TAENTLFYVK ESTLWLTSLN ACLDPFIYFF LCKSFRNSLI SMLKCPNSAT SLSQDNRKKE QDGGDPNEET PM. It is sometimes possible for the material contained within the vial of "P2Y purinoceptor 12 (P2RY12), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.