Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Papillomavirus 18 Recombinant Protein | HPV 18 recombinant protein

Recombinant Human Papillomavirus 18

Average rating 0.0
No ratings yet
Purity
Protein is >95% pure as determined by 12% PAGE (Coomassie staining).
The recombinant HPV-16 fusion protein was purified by GSH affinity chromatography technique.
Synonyms
Papillomavirus 18; N/A; Recombinant Human Papillomavirus 18; HPV 18; Papillomavirus; HPV; Papilloma Virus; HPV 18 recombinant protein
Ordering
Host
E Coli
Purity/Purification
Protein is >95% pure as determined by 12% PAGE (Coomassie staining).
The recombinant HPV-16 fusion protein was purified by GSH affinity chromatography technique.
Form/Format
Recombinant HPV-18 solution in Phosphate buffer and 3M Urea and 0.02% sodium azide as preservative.
Sterile filtered clear liquid formulation.
Concentration
0.3 mg/ml (varies by lot)
Sequence
VDVYLPPPSVARVVNTDDYVTPTSIFYHAGSSRLLTVGNPYFRVPAGGGNKQDIPKVSAYQYRVFRVQLPDPNKFGLPDTSIYNPETQRLVWACAGVEIGRGQPLGVGLSGHPFYNKLDDTESSHAATSNVSEDVRDNVSVDYKQTQLCILGCAPAIGEHWAKGTACKSRPLSQGDCPPLELKNTVLEDGDMVDTGYGAMDFSTLQDTKCEVPLDICQSICKYPDYLQMSADPYGDSMFFCLRREQLFARHFWNRAGTMGDTVPQSLYIKGTGMPASPGSCVYSPSPSGSIVTSDSQLFNKPYWLHKAQGHNNGVCWHNQLFVTVVDTTPSTNLTICASTQSPVPGQYDATKFKQYSRHVEEYDLQFIFQLCTITLTADVMSYIHSMNSSILEDWNFGVPPPPTTSLVDTYRFVQSVAITCQKDAAPAENKDPYDKLKFWNVDLKEKFSLDLDQYPLGRKFLVQAGLRRKPTIGPRKRSAPSATTSSKPA
Related Product Information for HPV 18 recombinant protein
Description: The Recombinant HPV-18 is a full length large capsid protein having a Mw of 56kDa expressed in E Coli and fused to a GST-Tag, having a total Mw of 83kDa, purified by standard chromatography.

Introduction: Human papillomavirus family consist of over 200 types. Over than 30 to 40 types of HPV are transferred via sexual contact and infect the anogenital region initiating genital warts. Persistent infection with "high-risk" HPV types results in skin warts and leads to precancerous lesions and invasive cancer. HPV infection is considered as a source for all incidents of cervical cancer. E2, E6, and E7 proteins of HPV-16 and 18 are considered the main viral oncoproteins that take part in cervical cancer. The type-specific antigen epitopes of E2, E6, and E7 proteins of HPV-16 are fused together and expressed in E. coli
Product Categories/Family for HPV 18 recombinant protein

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The HPV 18 (Catalog #AAA38840) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: VDVYLPPPSV ARVVNTDDYV TPTSIFYHAG SSRLLTVGNP YFRVPAGGGN KQDIPKVSAY QYRVFRVQLP DPNKFGLPDT SIYNPETQRL VWACAGVEIG RGQPLGVGLS GHPFYNKLDD TESSHAATSN VSEDVRDNVS VDYKQTQLCI LGCAPAIGEH WAKGTACKSR PLSQGDCPPL ELKNTVLEDG DMVDTGYGAM DFSTLQDTKC EVPLDICQSI CKYPDYLQMS ADPYGDSMFF CLRREQLFAR HFWNRAGTMG DTVPQSLYIK GTGMPASPGS CVYSPSPSGS IVTSDSQLFN KPYWLHKAQG HNNGVCWHNQ LFVTVVDTTP STNLTICAST QSPVPGQYDA TKFKQYSRHV EEYDLQFIFQ LCTITLTADV MSYIHSMNSS ILEDWNFGVP PPPTTSLVDT YRFVQSVAIT CQKDAAPAEN KDPYDKLKFW NVDLKEKFSL DLDQYPLGRK FLVQAGLRRK PTIGPRKRSA PSATTSSKPA. It is sometimes possible for the material contained within the vial of "Papillomavirus 18, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.