Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Pericentrin (Pcnt) Recombinant Protein | Pcnt recombinant protein

Recombinant Mouse Pericentrin (Pcnt) , partial

Average rating 0.0
No ratings yet
Gene Names
Pcnt; KEN; Pcnt2; C86676; kendrin; m239Asp; m275Asp; AW476095
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Pericentrin (Pcnt); N/A; Recombinant Mouse Pericentrin (Pcnt) , partial; Pcnt recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2545-2810. Partial.
Sequence
LCAAGLLTSFTNHTVDRTIKDWTSSNEKAVSSLMRTLEELKSELSMPTSFQKKMTAELQVQLMNELLSDNDALTKAVGMATREKAELCRTVSRLEKTLKHHTQKGCVLNRQSKSSLKQDGTDLQSSLRHSDPEWHSQTTSGDTNTCNIKMEKLYLHYLRAESFRKALIYQKKYLLLLIGGFQDSEQETLSMIAHLGVFPSKADKKITMSRPFTKFRTAVRVVIAVLRLRFLVKKWQEVDRKGALVHPKSTRHGHRTSQRQRSPSGP
Sequence Length
2810
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Pcnt recombinant protein
This protein binds to calmodulin and is expressed in the centrosome. It is an integral component of the pericentriolar material (PCM). The protein contains a series of coiled-coil domains and a highly conserved PCM targeting motif called the PACT domain near its C-terminus. The protein interacts with the microtubule nucleation component gamma-tubulin and is likely important to normal functioning of the centrosomes, cytoskeleton, and cell-cycle progression. Mutations in this gene cause Seckel syndrome-4 and microcephalic osteodysplastic primordial dwarfism type II.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37.7 kDa
NCBI Official Full Name
pericentrin isoform b
NCBI Official Synonym Full Names
pericentrin (kendrin)
NCBI Official Symbol
Pcnt
NCBI Official Synonym Symbols
KEN; Pcnt2; C86676; kendrin; m239Asp; m275Asp; AW476095
NCBI Protein Information
pericentrin
UniProt Protein Name
Pericentrin
UniProt Gene Name
Pcnt
UniProt Synonym Gene Names
Pcnt2

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The Pcnt pcnt (Catalog #AAA113943) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2545-2810. Partial. The amino acid sequence is listed below: LCAAGLLTSF TNHTVDRTIK DWTSSNEKAV SSLMRTLEEL KSELSMPTSF QKKMTAELQV QLMNELLSDN DALTKAVGMA TREKAELCRT VSRLEKTLKH HTQKGCVLNR QSKSSLKQDG TDLQSSLRHS DPEWHSQTTS GDTNTCNIKM EKLYLHYLRA ESFRKALIYQ KKYLLLLIGG FQDSEQETLS MIAHLGVFPS KADKKITMSR PFTKFRTAVR VVIAVLRLRF LVKKWQEVDR KGALVHPKST RHGHRTSQRQ RSPSGP. It is sometimes possible for the material contained within the vial of "Pericentrin (Pcnt), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.