Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Plasmodium falciparum L-lactate dehydrogenase Recombinant Protein

Recombinant Plasmodium falciparum L-lactate dehydrogenase

Average rating 0.0
No ratings yet
Synonyms
Plasmodium falciparum L-lactate dehydrogenase; N/A; Recombinant Plasmodium falciparum L-lactate dehydrogenase; Plasmodium falciparum L-lactate dehydrogenase recombinant protein
Ordering
Host
E Coli
Form/Format
20mM Tris-HCl, 500mM NaCl, pH8.0, 50% glycerol
Sequence Positions
56-310aa
Sequence
YSNCKVSGSNTYDDLAGADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKKNCPNAGGGGMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALA
Tag
his-tag

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The Plasmodium falciparum L-lactate dehydrogenase (Catalog #AAA278928) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 56-310aa. The amino acid sequence is listed below: YSNCKVSGSN TYDDLAGADV VIVTAGFTKA PGKSDKEWNR DDLLPLNNKI MIEIGGHIKK NCPNAGGGGM AESYLKDLKK VLICSTLLEG QYGHSDIFGG TPVVLGANGV EQVIELQLNS EEKAKFDEAI AETKRMKALA. It is sometimes possible for the material contained within the vial of "Plasmodium falciparum L-lactate dehydrogenase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.