Phospholipase D3 Recombinant Protein | Pld3 recombinant protein
Recombinant Mouse Phospholipase D3 (Pld3)
Gene Names
Pld3; Sam-9
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Phospholipase D3; N/A; Recombinant Mouse Phospholipase D3 (Pld3); Pld3 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-488. Full length.
Sequence
MKPKLMYQELKVPVEEPAGELPLNEIEAWKAAEKKARWVLLVLILAVVGFGALMTQLFLWEYGDLHLFGPNQRPAPCYDPCEAVLVESIPEGLEFPNATTSNPSTSQAWLGLLAGAHSSLDIASFYWTLTNNDTHTQEPSAQQGEEVLQQLQALAPRGVKVRIAVSKPNGPLADLQSLLQSGAQVRMVDMQKLTHGVLHTKFWVVDQTHFYLGSANMDWRSLTQVKELGVVMYNCSCLARDLTKIFEAYWFLGQAGSSIPSTWPRSFDTRYNQETPMEICLNGTPALAYLASAPPPLCPSGRTPDLKALLNVVDSARSFIYIAVMNYLPTMEFSHPRRFWPAIDDGLRRAAYERGVKVRLLISCWGHSDPSMRSFLLSLAALHDNHTHSDIQVKLFVVPTDESQARIPYARVNHNKYMVTERASYIGTSNWSGSYFTETAGTSLLVTQNGHGGLRSQLEAVFLRDWESPYSHDLDTSANSVGNACRLL
Sequence Length
488
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Pld3 recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for Pld3 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
58.2 kDa
NCBI Official Full Name
phospholipase D3
NCBI Official Synonym Full Names
phospholipase D family, member 3
NCBI Official Symbol
Pld3
NCBI Official Synonym Symbols
Sam-9
NCBI Protein Information
phospholipase D3
UniProt Protein Name
Phospholipase D3
UniProt Gene Name
Pld3
UniProt Synonym Gene Names
Sam9; PLD 3; SAM-9
UniProt Entry Name
PLD3_MOUSE
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The Pld3 pld3 (Catalog #AAA230853) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-488. Full length. The amino acid sequence is listed below: MKPKLMYQEL KVPVEEPAGE LPLNEIEAWK AAEKKARWVL LVLILAVVGF GALMTQLFLW EYGDLHLFGP NQRPAPCYDP CEAVLVESIP EGLEFPNATT SNPSTSQAWL GLLAGAHSSL DIASFYWTLT NNDTHTQEPS AQQGEEVLQQ LQALAPRGVK VRIAVSKPNG PLADLQSLLQ SGAQVRMVDM QKLTHGVLHT KFWVVDQTHF YLGSANMDWR SLTQVKELGV VMYNCSCLAR DLTKIFEAYW FLGQAGSSIP STWPRSFDTR YNQETPMEIC LNGTPALAYL ASAPPPLCPS GRTPDLKALL NVVDSARSFI YIAVMNYLPT MEFSHPRRFW PAIDDGLRRA AYERGVKVRL LISCWGHSDP SMRSFLLSLA ALHDNHTHSD IQVKLFVVPT DESQARIPYA RVNHNKYMVT ERASYIGTSN WSGSYFTETA GTSLLVTQNG HGGLRSQLEA VFLRDWESPY SHDLDTSANS VGNACRLL. It is sometimes possible for the material contained within the vial of "Phospholipase D3, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.