Rabbit AATF Polyclonal Antibody | anti-AATF antibody
AATF antibody - N-terminal region
Gene Names
AATF; DED; BFR2; CHE1; CHE-1
Reactivity
Dog, Horse, Human, Mouse, Rabbit, Rat, Yeast
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
AATF, Antibody; AATF antibody - N-terminal region; anti-AATF antibody
Host
Rabbit
Reactivity
Dog, Horse, Human, Mouse, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEE
Sequence Length
560
Applicable Applications for anti-AATF antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Dog: 77%; Horse: 85%; Human: 100%; Mouse: 77%; Rabbit: 100%; Rat: 90%; Yeast: 90%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human AATF
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-AATF antibody
This is a rabbit polyclonal antibody against AATF. It was validated on Western Blot and immunohistochemistry
Target Description: The AATF gene encodes a protein that was identified on the basis of its interaction with MAP3K12/DLK, a protein kinase known to be involved in the induction of cell apoptosis. This gene product contains a leucine zipper, which is a characteristic motif of transcription factors, and was shown to exhibit strong transactivation activity when fused to Gal4 DNA binding domain. Overexpression of this gene interfered with MAP3K12 induced apoptosis.
Target Description: The AATF gene encodes a protein that was identified on the basis of its interaction with MAP3K12/DLK, a protein kinase known to be involved in the induction of cell apoptosis. This gene product contains a leucine zipper, which is a characteristic motif of transcription factors, and was shown to exhibit strong transactivation activity when fused to Gal4 DNA binding domain. Overexpression of this gene interfered with MAP3K12 induced apoptosis.
Product Categories/Family for anti-AATF antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63kDa
NCBI Official Full Name
protein AATF
NCBI Official Synonym Full Names
apoptosis antagonizing transcription factor
NCBI Official Symbol
AATF
NCBI Official Synonym Symbols
DED; BFR2; CHE1; CHE-1
NCBI Protein Information
protein AATF
UniProt Protein Name
Protein AATF
UniProt Gene Name
AATF
UniProt Synonym Gene Names
CHE1; DED
UniProt Entry Name
AATF_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The AATF aatf (Catalog #AAA197233) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AATF antibody - N-terminal region reacts with Dog, Horse, Human, Mouse, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's AATF can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the AATF aatf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EEEEDEESGM EEGDDAEDSQ GESEEDRAGD RNSEDDGVVM TFSSVKVSEE. It is sometimes possible for the material contained within the vial of "AATF, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
