Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23476_WB8.jpg WB (Western Blot) (WB Suggested Anti-ACO1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human kidney)

Rabbit ACO1 Polyclonal Antibody | anti-ACO1 antibody

ACO1 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
ACO1; IRP1; ACONS; HEL60; IREB1; IREBP; IREBP1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
ACO1, Antibody; ACO1 antibody - N-terminal region; anti-ACO1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNC
Sequence Length
889
Applicable Applications for anti-ACO1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 91%; Horse: 92%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 86%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ACO1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ACO1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human kidney)

product-image-AAA23476_WB8.jpg WB (Western Blot) (WB Suggested Anti-ACO1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human kidney)

WB (Western Blot)

(Lanes:1. 60 ug mouse liver extract 2. 60 ug mouse liver extract 3. 60 ug mouse liver extractPrimary Antibody Dilution:1:500Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:3000Gene Name:ACO1Submitted by:Dr. Hao Zhu, University of Kansas Medical Center)

product-image-AAA23476_WB7.jpg WB (Western Blot) (Lanes:1. 60 ug mouse liver extract 2. 60 ug mouse liver extract 3. 60 ug mouse liver extractPrimary Antibody Dilution:1:500Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:3000Gene Name:ACO1Submitted by:Dr. Hao Zhu, University of Kansas Medical Center)

WB (Western Blot)

(Lanes:1. 45ug capan1 cell lysate2. 45 ug HPAF cell lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-Rabbit HRPSecondary Antibody Dilution:1:5000Gene Name:ACO1Submitted by:Dr. Pankaj Singh, UNMC, Omaha, NE)

product-image-AAA23476_WB6.jpg WB (Western Blot) (Lanes:1. 45ug capan1 cell lysate2. 45 ug HPAF cell lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-Rabbit HRPSecondary Antibody Dilution:1:5000Gene Name:ACO1Submitted by:Dr. Pankaj Singh, UNMC, Omaha, NE)

WB (Western Blot)

(Host: RabbitTarget Name: ACO1Sample Type: Fetal KidneyLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/lane/LaneGel Concentration: 0.12)

product-image-AAA23476_WB5.jpg WB (Western Blot) (Host: RabbitTarget Name: ACO1Sample Type: Fetal KidneyLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/lane/LaneGel Concentration: 0.12)

WB (Western Blot)

(Host: RabbitTarget Name: ACO1Sample Tissue: Human Ovary TumorAntibody Dilution: 1ug/ml)

product-image-AAA23476_WB4.jpg WB (Western Blot) (Host: RabbitTarget Name: ACO1Sample Tissue: Human Ovary TumorAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Sample Type: HePG2Lanes :Lane 1: 100ug HePG2 lysatePrimary Antibody Dilution :1:1000Secondary Antibody :Goat anti rabbit-HRPSecondary Antibody Dilution :1:8000Gene Name :ACO1Submitted by :José Antonio Bárcena, University of Córdoba)

product-image-AAA23476_WB3.jpg WB (Western Blot) (Sample Type: HePG2Lanes :Lane 1: 100ug HePG2 lysatePrimary Antibody Dilution :1:1000Secondary Antibody :Goat anti rabbit-HRPSecondary Antibody Dilution :1:8000Gene Name :ACO1Submitted by :José Antonio Bárcena, University of Córdoba)

IHC (Immunohistochemistry)

(Sample Type :Human Capan1 cells (Pancreatic cancer cell line)Primary Antibody Dilution :1:300Secondary Antibody :Anti-rabbit-AlexaFluor-488Secondary Antibody Dilution :1:200Color/Signal Descriptions :ACO1: Green DAPI: BlueGene Name :ACO1Submitted by :Dr. Pankaj Singh, UNMC, Omaha, NE)

product-image-AAA23476_IHC2.jpg IHC (Immunohistochemistry) (Sample Type :Human Capan1 cells (Pancreatic cancer cell line)Primary Antibody Dilution :1:300Secondary Antibody :Anti-rabbit-AlexaFluor-488Secondary Antibody Dilution :1:200Color/Signal Descriptions :ACO1: Green DAPI: BlueGene Name :ACO1Submitted by :Dr. Pankaj Singh, UNMC, Omaha, NE)

IHC (Immunohistochemistry)

(Rabbit Anti-ACO1 AntibodyParaffin Embedded Tissue: Human MuscleCellular Data: Skeletal muscle cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA23476_IHC.jpg IHC (Immunohistochemistry) (Rabbit Anti-ACO1 AntibodyParaffin Embedded Tissue: Human MuscleCellular Data: Skeletal muscle cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-ACO1 antibody
This is a rabbit polyclonal antibody against ACO1. It was validated on Western Blot and immunohistochemistry

Target Description: ACO1, also known as iron regulatory element binding protein 1 (IREB1), is a cytosolic protein which binds to iron-responsive elements (IREs). It plays a central role in cellular iron homeostasis. It was also shown to have aconitase activity, and hence grouped with the aconitase family of enzymes.Aconitase 1, also known as iron regulatory element binding protein 1 (IREB1), is a cytosolic protein which binds to iron-responsive elements (IREs). IREs are stem-loop structures found in the 5' UTR of ferritin mRNA, and in the 3' UTR of transferrin receptor mRNA. The iron-induced binding to the IRE results in repression of translation of ferritin mRNA, and inhibition of degradation of the otherwise rapidly degrading transferrin receptor mRNA. Thus, IREB1 plays a central role in cellular iron homeostasis. It was also shown to have aconitase activity, and hence grouped with the aconitase family of enzymes.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
48
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
98kDa
NCBI Official Full Name
cytoplasmic aconitate hydratase
NCBI Official Synonym Full Names
aconitase 1
NCBI Official Symbol
ACO1
NCBI Official Synonym Symbols
IRP1; ACONS; HEL60; IREB1; IREBP; IREBP1
NCBI Protein Information
cytoplasmic aconitate hydratase
UniProt Protein Name
Cytoplasmic aconitate hydratase
UniProt Gene Name
Aco1
UniProt Synonym Gene Names
Ireb1; Irebp; Aconitase; IRP1; IRE-BP 1
UniProt Entry Name
ACOC_MOUSE

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ACO1 aco1 (Catalog #AAA23476) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ACO1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ACO1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the ACO1 aco1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MSNPFAHLAE PLDPVQPGKK FFNLNKLEDS RYGRLPFSIR VLLEAAIRNC. It is sometimes possible for the material contained within the vial of "ACO1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.